CAZyme Information: MGYG000003904_00319

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000003904_00319
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		35159.62	6.6272

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003904	2545601	MAG	China	Asia

• Gene Location: Start: 194; End: 1129 Strand: +

Full Sequence      

MSAVHFDKFYQVIEGCKLIGWQKFPDVFNPEFEAGLAKALRGRFRKTTTAPYCIGYFVDN
ELSWGTSDTFLAEGALRSPATQPAKIALADHLKKKYGDIEALNRAWGTSYRDFDDFLAKN
DMPADPERAKPDLEEFNDVIVNRYFATCKAVINREAPGKLYFGCRFNDWNVKVIRTAAKY
LDACSFNLYRPQIGCWSLPEGVDMPVVVGEWHYGTANSGPSHPGLQAAANQTERARGFDR
YIRSALWNPQIAGVHYFKYCDQATTGRPPDDENIQCGFVDVTDTPYREMVDAARKVSSEM
YQYRLSEGPGK

Enzyme Prediction     

No EC number prediction in MGYG000003904_00319.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	17	301	2.9e-73	0.45941807044410415

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	9.68e-07	51	189	127	262	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	0.006	62	145	153	238	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47039.1	8.05e-172	1	306	409	714
ASV75458.1	5.81e-87	21	308	401	685
AVM47036.1	1.68e-85	21	306	576	860
AVM44573.1	3.24e-82	21	304	580	862
AWI09682.1	1.51e-80	24	304	1295	1574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z6P_A	6.28e-60	21	305	469	763	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
4BQ2_A	1.95e-59	21	305	451	747	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	5.20e-59	21	305	451	747	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	4.11e-56	21	307	469	765	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	5.84e-55	21	307	656	955	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	1.10e-38	21	301	612	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003904_00319.