CAZyme Information: MGYG000003904_00495

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000003904_00495
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706		79162.81	6.4582

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003904	2545601	MAG	China	Asia

• Gene Location: Start: 46; End: 2166 Strand: +

Full Sequence      

MKPAGPTPGRAEGFLFGICSHPQRWSLGDQELEALAMAYCGAKVLRNDTGWGNIQPSPDR
WNFESMDRKVELFGRYHIELAPIWAYTPRWAAAPEVRNREWRAWFRSLPDLKAWETYVAT
LTKRYRGKIRLWEIWNEPDFSGSTFNSDEYAEMMKIAWRAAKAVDPEVVIQSGGFATVKD
HPSRKGNFHEEALVKGRGFFDIHAYHEHGRFPTFQAAVEERFLPMRERTGTTVPWYANET
ALSSLGGERGQALALFKKLIFSWANGAIGYNWYDLRNDGFDAKNNEHNYGMMTNDFQPKS
VYVVYNTLAGTLSGAQYLKRIDCGTPELYVYLFSRNGELLAGIWNETARGAAVPLLFRTD
ADEAECVDLMGNRRTVAVRDGIVVSEAGRDPVILRLKHASQCVWTGNLVLLESGGSAVPG
CDMELAVRVLNPYAQEREFRLTPIPPTGVKVVPAEHMKRIAPGKTARLVYRLPIPENYLE
TSNLLLDYAFLPDGAAGRISIPLVPARRIPSGEMASDKPDFRMDRRAQSVSLFEADPGKV
HLTWQGPEDRSALVWLRREGETLRLRFDVTDDRHIQPNHGVGVWRGDNVQLALQLPDRAG
MWEVGLTRLDSGENEVYIWSAPTGFSPAESAASVKLTTSRSGTLTRYEAELPLKAFGMTP
EILAAGIRFNALVNDDDGEGREGWIQIAPGIGEDKDPAKYPLILLP

Enzyme Prediction     

No EC number prediction in MGYG000003904_00495.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	60	347	4e-21	0.7238979118329466

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.15e-72	519	705	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	1.12e-11	543	683	29	167	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
COG3693	XynA	3.10e-10	29	167	47	186	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam00331	Glyco_hydro_10	1.24e-08	10	168	6	163	Glycosyl hydrolase family 10.
smart00633	Glyco_10	5.31e-08	51	168	3	123	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47149.1	5.25e-222	1	704	594	1305
AVM46276.1	8.17e-210	1	704	430	1135
AVM44759.1	1.83e-201	6	704	262	963
AHF94342.1	4.06e-165	1	704	316	1031
AHF90198.1	1.02e-153	1	703	303	1003

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003904_00495.