CAZyme Information: MGYG000003904_01806

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000003904_01806
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		66321.77	5.3259

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003904	2545601	MAG	China	Asia

• Gene Location: Start: 396; End: 2159 Strand: +

Full Sequence      

MKFATMIGEIRIAGELRNWNLACTKESPEPGVELVHFAFRAPELSDPPNVRLEWRVPQLD
MQFRWHTAATFQRNIPPDWGAPLESSLAYQVPAVQLGALDGENRLTFALSEALRTVKIKA
GVCEEANEIACSIELFSVPEAPLSSYETVLRLDTRHLFYADVLRQTFRWYETFPECTPAA
VPAAAFDPVYSSWYSFHQNLFDRELEAECRLAAACGMKGIIVDDGWQTDDCNRGYAYCGD
WEISKNRFPDMRAHVAKVHELGMKYLVWYSVPFIGKKSRNLERFRGKFLARVDRLDTCVL
DPRFPEVRAFLISIYENALREWDIDGFKLDFIDMFRFDGEDPAVRENYAGRDIKSLPEAV
DRLLSETMAHLNRIKPGILIEFRQAYIGPAIRKYGSMFRAGDCPADVLSNRVRTIDLRLS
SGATAVHSDMLEWNSADSAESAALQFLNILFSVPQISVRLESLPERHREMLRFWLDFWSC
HRETLMHGTLRPLHPMLNYPIVIADGADEQIVAVYNPGMTVPVDCIPGRRSLVDNASGAE
GLVLDLASRPVSAEVFDTTGRAGEAGVPESGLARVRVPLSGVLSLRF

Enzyme Prediction     

No EC number prediction in MGYG000003904_01806.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	187	494	8.3e-30	0.45058139534883723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.31e-59	188	478	4	297	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	2.20e-10	212	381	67	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	1.17e-08	188	398	3	206	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	2.19e-07	177	430	257	509	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd14792	GH27	1.01e-06	190	272	5	88	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	1.45e-272	1	587	1	587
CQR57728.1	1.28e-191	11	586	12	588
AZN41080.1	1.59e-188	27	582	32	594
QGQ97599.1	3.83e-187	9	586	10	588
AIQ68815.1	2.05e-183	9	586	10	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JHP_A	1.14e-07	188	330	361	519	Crystalstructure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_B Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_C Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_D Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ARP5	8.11e-07	191	330	331	485	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
Q5AU92	1.88e-06	188	330	353	511	Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003904_01806.