CAZyme Information: MGYG000003904_02105

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis
• CAZyme ID: MGYG000003904_02105
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531		60345.37	7.6269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003904	2545601	MAG	China	Asia

• Gene Location: Start: 10; End: 1605 Strand: +

Full Sequence      

MTSAPGLRWHFEFKSGLDLDDFTQAAPLTIRLRGGVPGKTYQLTTTWYLVDPRGALGRLV
TFKGGPEWQELTFPVPRRPSGNKTRLLVFGLSDIADIDIAEVRLGKSSKISVELASRPDK
SAEALLLRGRASEKDTQVTLHVKDSAGKTTSRNVPVTNGRFEYLWKNPPLSLQQYNTIHA
SGNHSGKSISLSVFGYRPNYDFAWLKVKGTQIVTASGEEFIPAGIGYARDVIISNQDDAV
MEYAKARGLNTIRLPFYTRYFNNNLNEPIDLEAHMNDFIDPVLQAAKRHDMYVILDDHGY
FSGKIDEAKARQQQNVSLWDDAGVAEWISRWRRIAERYKDEPHILGYELMNEPHDIRPEL
AREWYTRAIREIRKVDKKHIILVGSADWSHSRSLEKTWGPTASTADAPYNNLVFAFHDYP
LDNHPWIVKKHIVNFRDRHQVPVMCTEFGATHWDKGETVCREFEAGMLTLCARERVGWMI
WALGELIDQPRSPYNEVDKVGFGPPRSMDSCAYSDLWIPAARVTASPFPQP

Enzyme Prediction     

No EC number prediction in MGYG000003904_02105.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	230	485	1.5e-47	0.7381818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.01e-37	213	484	1	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.51e-14	242	432	80	269	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT89144.1	9.70e-155	201	529	30	363
ADV42635.1	4.69e-23	229	513	101	365
QEC61327.1	7.73e-23	241	481	100	329
QSZ34361.1	6.49e-22	205	495	6	352
SDS60303.1	6.58e-22	200	500	60	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AMC_A	2.03e-15	238	481	36	286	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
4EE9_A	2.12e-15	238	419	32	201	Crystalstructure of the RBcel1 endo-1,4-glucanase [uncultured bacterium],4M24_A Crystal structure of the endo-1,4-glucanase, RBcel1, in complex with cellobiose [uncultured bacterium]
5HPC_A	3.36e-15	243	484	57	302	Structureof XacCel5A crystallized in the space group P41212 [Xanthomonas citri pv. citri str. 306]
7P6G_A	5.14e-15	238	419	32	201	ChainA, Endoglucanase [uncultured bacterium],7P6G_B Chain B, Endoglucanase [uncultured bacterium],7P6H_A Chain A, Endoglucanase [uncultured bacterium],7P6H_B Chain B, Endoglucanase [uncultured bacterium]
4W7U_A	5.76e-15	243	484	57	302	Crystalstructure of XacCel5A in the native form [Xanthomonas citri pv. citri str. 306],4W7V_A Crystal structure of XacCel5A in complex with cellobiose [Xanthomonas citri pv. citri str. 306],4W7W_A High-resolution structure of XacCel5A in complex with cellopentaose [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	3.44e-18	203	441	2	270	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
P23548	1.23e-15	189	426	18	284	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
P58599	1.08e-12	208	419	118	319	Endoglucanase OS=Ralstonia solanacearum (strain GMI1000) OX=267608 GN=egl PE=3 SV=1
P17974	1.88e-11	178	419	81	321	Endoglucanase OS=Ralstonia solanacearum OX=305 GN=egl PE=1 SV=2
P23044	3.55e-09	272	522	94	361	Endoglucanase 1 OS=Robillarda sp. (strain Y-20) OX=72589 GN=eg 1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003904_02105.