CAZyme Information: MGYG000003907_01239

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Butyricicoccus
• CAZyme ID: MGYG000003907_01239
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
687		75863.59	4.3992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003907	1336434	MAG	China	Asia

• Gene Location: Start: 197; End: 2260 Strand: -

Full Sequence      

MFDMDMTSIVYAWDPEKEDYTEYEVLRGRENRIWSDLDEIPKDLQNAFIAIEDKRFYEHK
GVDWKRTANGVINWIVGKEGGGSTITQQLIKNLTDDKDYSVKRKLNEIFRALQLEKDLGD
KDRILEMYLNLIYLGQGAYGVNTAATTYFSKDLDELNLAECAILAGITKNPSRYDPFNHP
ETIKERQETILNEMCKQGMISESERDEAKAQPLEYKYEAAKEARENTYSYFTDAVINDVI
NDLVEKKDYPLELAKWKVTSGGVQIYTTVEPAVQAAMEEVYEDDSNFPNISRNGMRPESA
MVICNNQGDVVGIVGGRGKKTDNRVLVRADSPRQAGSSIKPLSAYGPAMDAGLITPYSVR
DNAPFKEIDGRAWPRNDSGGYTGPMTIRSAVAKSTNAIAVRVVDELTPQAAYDFLTEQLG
FKHLNSADIDLAPMALGGMNGGVTVREMAAGFSIFLNDGIFNGARTYTKVLNSDGTVLLE
NEPLERQVFEREQTVYYMRDVLKGVTSSAMGGTARRINVPGMDVGGKTGTSQKKRDLWFC
GFTPYYAGATWFGYDSSYDLSGVSGNPSLTIWNKVMNKVHENLEPAEFDMGDSDNFEKQS
YCTVSGLAPSSACRANGTVETGRYWKGDAPSKVCTECSYVAPEPEPEPEEPGAVDPENPG
AGEAGGTTAPTDPSGGTLPQTQDPEDD

Enzyme Prediction     

No EC number prediction in MGYG000003907_01239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	28	194	1.3e-64	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	7.66e-177	31	582	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.63e-158	28	589	72	606	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.12e-128	6	588	47	727	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	6.52e-79	27	194	8	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	5.12e-77	32	613	58	592	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL43378.1	3.82e-165	2	639	67	714
QBB65500.1	4.38e-165	2	634	42	694
ALP94484.1	1.07e-164	2	634	74	726
QIA31344.1	1.85e-155	2	635	70	722
ANU41033.1	1.06e-154	2	635	46	698

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	1.18e-78	24	641	32	817	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	1.14e-63	113	588	2	469	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3DWK_A	2.48e-62	37	610	32	608	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.74e-59	37	610	41	617	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG7_B	7.09e-58	113	557	2	435	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97GR5	1.63e-98	39	612	100	706	Penicillin-binding protein 1A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pbpA PE=3 SV=1
Q0SRL7	7.85e-98	29	634	88	721	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q0TNZ8	1.00e-96	29	634	88	721	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q8XJ01	4.03e-94	29	589	88	675	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
A7GHV1	1.05e-92	30	621	74	696	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003907_01239.