CAZyme Information: MGYG000003908_01338

Basic Information

• Species: Odoribacter sp900541415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900541415
• CAZyme ID: MGYG000003908_01338
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
873	MGYG000003908_5|CGC1	101534.51	7.1204

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003908	3732484	MAG	China	Asia

• Gene Location: Start: 147103; End: 149724 Strand: -

Full Sequence      

MKLNCLKNVCLLFAVFYGSLLTASPLRQELNEGWKFRQARLTNWYPASVPGVVHTDLLAN
GIIEDPFFRLNERGLQWIDKEDWIYETHFTLSPEMREKQNVRLDFKGLDTYADVYLNDQK
ILSANNMFREWQADIKKYLRPGENTLRIYFHSPLKIDIPKWDSLPFQYEAGNDQSENGGV
FDKKVSVFARKAGYHYGWDWGPRLVTSGIWRPVYLEAWDNLRIENIQIIQDQVSEKSAKI
RVVAEIRADENLENIRLTVRDPESGKTFGTVSTSLQKGLNKVTSAFTIRNPKLWWSHGLG
TPHLYQFQTVAELNGKPADSHTVSTGIRSLRLITQPDKDGRTFYFELNGVPVFAKGANYI
PCDNFLPRVSRATYEKTIKDAVDANMNMLRVWGGGTYEDDYFYELCDKYGIMIWQDFMFA
CSLYPAEGELLENIRQEAIDNVRRLRNHPSIALWCGNNECNDAWFGWGWKRKYERQNPEY
AQKIWKQFTDQYHVVLPEVVKEYAPGTDYRPSSPFSTFGNKSNDHDGDRHYWEVWHGKVP
ITNYNLERSRFFSEYGFQSFPEFQSVKQYAPNPEDWNITSEVMMSHQRGGAHANNLIETY
LLNEYRKPKDFESFLYMNHLLQGDAIKTAIEAHRRDMPYCMGTLFWQHNDCWPVASWSSR
DYYGRWKAQHYFAREAYRDLLVSPIAKNDTLYIYTVSDRRSTAPGSLEITAITMTGDTVS
QLRKNIRIPAQSSYMAYSAPVAELLKGYNPQEVVISARFWDKAGNQYENHYFLVQQKDMN
YQQPKINKTITPCENGFEITLSSDKFARGVFLSIEGIDNFFENNYFDLLPGKAYRVKVQT
RLPLAEFEKQLKITSLTDAYAQQPATAANSREK

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	23	804	2.2e-114	0.7646276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.17e-122	24	836	9	799	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	8.13e-22	783	858	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	5.66e-19	17	461	24	455	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	4.49e-16	689	778	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	2.98e-15	222	328	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68488.1	0.0	2	860	5	865
ALJ60279.1	0.0	2	860	5	865
QUT88714.1	0.0	2	860	5	865
QUT74423.1	0.0	18	860	21	864
QGT72566.1	0.0	6	860	10	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	4.91e-228	30	862	11	840	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	5.24e-228	30	862	13	842	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	7.65e-228	30	836	13	816	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.03e-227	30	836	11	814	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	6.26e-226	30	862	11	840	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2QYN2	9.94e-134	23	838	2	828	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q0CCA0	1.90e-133	23	671	2	645	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1CGA8	1.53e-132	23	843	2	833	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q4WAH4	2.57e-129	24	671	2	647	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1D911	3.61e-129	24	843	2	833	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.098381	0.899661	0.001105	0.000263	0.000262	0.000310

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003908_01338.