CAZyme Information: MGYG000003908_01416

Basic Information

• Species: Odoribacter sp900541415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900541415
• CAZyme ID: MGYG000003908_01416
• CAZy Family: PL8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817		91297.11	6.9153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003908	3732484	MAG	China	Asia

• Gene Location: Start: 113684; End: 116137 Strand: -

Full Sequence      

MRIAGILFLLLFCGGVAAQEITFGEKEYDFGVIREDSGTVYHDFYFMNTGDKPLRIQSVV
VSCGCTSSEWPRNEVKPGEKACIRVSYHPQGRAEKKFTKVAEVYTNSVNFGTHRGVHDLY
VSGEVIKGEKHIQPEYRLEVAGKEFPGNTRTEGVFAGILGKMQAELFQRIPIHRNDSLTI
NYVAALQRGGSWADIDYSCYFRTNWEPVRHLGRVEVLARSYVVAGGKFCGNDTLFAAIRD
ALAFWVEAHPKCHNWWYNQIAVPQNLGNILVLIDRGKQVLPEELQNRLFGMMAWPDPRKW
TGANKLDIALHHLQRGCLLQNDSIVSVAAQQIFYPVRITTAEGIQPDLSYHQHDNQLYIG
SYGTVFAEGVTRVADWLQGTPYALQGEQLRLFSEFIRSTYLNVFRGGYIDFSVVGRGISR
ENALDGRGTVDMLKKLERLDSMYAGEYAEAIVRFSQPGHSDYCRSDRTAVYWRSDYALHN
RKGFDFSVRTASVRTRKTESGNGENLCGGFLSDGATCIRRHGDEYYNIFPVWDWNKVPGV
TAPEASTAIATNWGEMGKSVFSGGVSDGQSGVMAFVLDDRGIKASKSWFFFEHEVVCLGA
GINSGAGMRVTTCLNQCLLNGEVTTSAGKQIPSEKTDGPGQERKLTWVLHDSVLYYFPQP
TEVCIYAGMQSGNWNQINYNYSAERLEKGVFKLWFDHGSGVEDGTYAYIVAPGITDPQAY
RGGDVEIVVNRADRQAVYNRAEDQLQAVFYQAGEITYKGMTLAVEHPCAILMKGWCGEKT
EVLLTDPSQKADTIGWKIRGNGRDISGKAGVTFAVYR

Enzyme Prediction     

EC	4.2.2.5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	470	714	2.2e-96	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.90e-135	143	773	7	680	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	2.30e-91	470	715	3	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	1.07e-57	182	451	36	317	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam07610	DUF1573	2.17e-31	21	125	1	98	Protein of unknown function (DUF1573). These hypothetical proteins, from bacteria such as Rhodopirellula baltica, Bacteroides thetaiotaomicron, and Porphyromonas gingivalis, share a region of conserved sequence towards their N-termini.
pfam02884	Lyase_8_C	2.52e-11	730	794	3	66	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM57814.1	1.23e-229	9	791	13	791
AVM54023.1	1.36e-224	11	790	14	791
ABW87764.1	9.78e-211	158	790	38	673
ACU03008.1	9.15e-172	171	799	42	673
AAC83383.1	9.15e-172	171	799	42	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	1.67e-173	171	799	20	651	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	3.34e-173	171	799	42	673	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
2E22_A	7.66e-34	192	812	43	723	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]
2E24_A	1.35e-33	192	812	43	723	ChainA, Xanthan lyase [Bacillus sp. GL1]
1J0M_A	3.16e-33	192	812	43	723	CrystalStructure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1],1J0N_A Crystal Structure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	1.83e-172	171	799	42	673	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	6.74e-33	192	812	68	748	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.999119	0.000148	0.000157	0.000137	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003908_01416.