CAZyme Information: MGYG000003908_01699

Basic Information

• Species: Odoribacter sp900541415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900541415
• CAZyme ID: MGYG000003908_01699
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		32010.54	6.5019

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003908	3732484	MAG	China	Asia

• Gene Location: Start: 23588; End: 24412 Strand: -

Full Sequence      

MAKKKILFISQEITPYLPESEMAHIGRFLPQGIQEKGKEIRTFMPRYGCINERRNQLHEV
IRLSGMNLIINDTDHPLIIKVASIQAARMQVYFIDNEDYFQRKHIVADDNGTFFPDNDER
AIFFARGVFETVKKLRWAPDLIYCQGWITALVPLYLKKEYQDDPVFAHSKIVFSTYNDQF
EGSLHKDFHKKILNDNINPKDISVLKEPTHTNVNKLAFDYSDGIIFNSNEIDPELKTYAQ
KSGKPLIEYSTQEQYIDEYSNFFDKILDTVPVKK

Enzyme Prediction     

No EC number prediction in MGYG000003908_01699.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	239	3.2e-45	0.4745762711864407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	2.72e-54	6	240	1	222	Starch synthase catalytic domain.
PRK14098	PRK14098	1.31e-42	1	197	1	200	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	6.65e-30	5	240	1	221	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	1.60e-24	5	182	2	160	glycogen synthase GlgA.
COG0297	GlgA	2.02e-18	5	182	2	171	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV43872.1	1.90e-171	1	274	1	273
ADY34094.1	1.90e-171	1	274	1	273
AZS31272.1	1.35e-156	1	268	1	268
QRO49825.1	5.49e-156	1	268	1	268
QIA09804.1	1.00e-132	1	266	1	266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNG_A	4.28e-09	2	188	36	231	GranuleBound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa],6GNG_B Granule Bound Starch Synthase I from Cyanophora paradoxa bound to acarbose and ADP [Cyanophora paradoxa]
6GNF_A	4.33e-07	6	182	24	207	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	7.72e-41	5	216	7	214	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
Q3B6C3	4.03e-40	5	216	7	214	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B4SC83	5.60e-40	5	216	7	214	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
B4S584	2.16e-38	5	193	7	196	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
A1BIY8	1.09e-37	5	193	7	196	Glycogen synthase OS=Chlorobium phaeobacteroides (strain DSM 266) OX=290317 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999770	0.000235	0.000018	0.000001	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003908_01699.