CAZyme Information: MGYG000003910_01566

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Dysosmobacter
• CAZyme ID: MGYG000003910_01566
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
891		97059.52	4.2527

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003910	2471901	MAG	China	Asia

• Gene Location: Start: 5959; End: 8634 Strand: +

Full Sequence      

MEHERKRRPAEQASHHRQTQKRKSSGGIVRRVLFIVGTLLLVGICTGAMMLGIFLKYVDT
TLSSSLQVRAEDYTMSLSSVIYYQDKESGEWVEYQNIYGVENRIWADLEDMPDALWQAAV
AIEDQRFFEHNGVDWLRTLHATFNMFTGGEDTFGGSTITQQLLKNMTGDNKGTVNRKVRE
IFRALEFEKNYTKWEILELYLNHIALGKSCYGVQTAAEYYFGKDVSELSVAECASIIAIT
NNPSMYGPMSTVVMTNPETGVQKTARELNKQRQELILDKMTQVTDPETGEPFLTEEEAEA
AKAEELHFTDGSTSAEDLVEAAAAQSGESRVNSWFVDQVFVEVAQDLADSMDISEDAAYT
LLYNGGYHIYTTMDPEIQEIVETVYEDRSNLDVTSAKGQKLQSGITIIDPSTGNIVAMAG
AVGEKEGNLLWNYAVSKRQVGSSMKPLTAYAPAIDAGVVTPATTFDNYPIQLLNGTPWPK
NSPNRYTGWTTVRTGIRDSINTIAVQSLQAVGVTEAFAFATENLNLSLTADDMNLSALGL
GGLTYGLSTVEMAAAYASFANGGIYNSPRMYVRVTDANGNTVLENEGESHVAMKESTAYL
MTDMLQNAVNYGTGSSAKFAGMSIAGKTGTTSDNYDRYFVGYTPYYCAAVWTGYSNPERI
SYSGNPAITMWKKVMQKIHETLPNKAFEKPATGLETVTVCADSGKLCTDACHADSRGDRA
VQILVASGTGPTEECTMHVFKDYCTEGQCLATEYCPEESVVQKGYLDYTREDYGPSIVAE
DNDALVSTQEKKLEEQGGCTVHNSGTVVIDPDTGEEGGESGSLTPDLDPSDPNYQPPIPP
TEGETEDGSSSGSTSGSTSGSTSGSSSGSAQTPDTGTSDDWWNDLWQNNAG

Enzyme Prediction     

No EC number prediction in MGYG000003910_01566.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	99	280	1.1e-58	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	5.10e-160	102	680	1	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	6.64e-149	22	690	4	608	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	8.52e-120	28	743	1	776	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	2.28e-66	98	281	8	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	1.42e-56	103	704	58	585	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO37805.1	0.0	20	812	21	822
QCI60634.2	0.0	17	812	16	816
BCK85139.1	0.0	1	812	1	825
BAK99350.1	0.0	17	818	19	824
QNL43378.1	1.17e-274	1	804	1	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	4.94e-75	95	776	32	859	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	2.60e-58	186	662	2	440	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	8.12e-52	186	662	2	440	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
4OON_A	9.27e-50	98	675	34	719	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	5.27e-48	107	692	31	601	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7FY32	2.13e-95	81	786	58	747	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	2.13e-95	81	786	58	747	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7GHV1	1.43e-94	81	786	58	747	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q0TNZ8	5.67e-94	34	738	31	724	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
Q0SRL7	2.35e-92	34	738	31	724	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999960	0.000083	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
32	54