CAZyme Information: MGYG000003911_01309

Basic Information

• Species: QAMM01 sp900762715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; QAMM01; QAMM01 sp900762715
• CAZyme ID: MGYG000003911_01309
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605		68747.78	5.1363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003911	1894498	MAG	China	Asia

• Gene Location: Start: 1831; End: 3648 Strand: -

Full Sequence      

MTAYERHKSALMNGWQTWNNASVLSHVMMPEGFGLSLGLKDYQNQKALDCVLIGQGEEQG
IVTPQAHAYDNSFTELTLEWFNNKITVTTALDNGELVFLVTPLKQPKKPSSLIVKGVNLW
NRETSVKREGETLLLSGGKKSIRVYMTASHNGELFVPCTTAYLSASLNEPIGISTGKYRT
VEEISQIIEKQRVRWAENKRKYGELAEAYSAMQTCQAWDTVYNPETDAPITTVSRIWNNN
WGGYVLFCWDTYFAALMQSLDNKDLAYCNAVEITKTAADCGFVPNFTAPGGFKTYDRSQP
PVGSMVCLMIYKRYQEKWFLEEVYPNLLSWNKWMFENRTVKDGLLAWGSNPYESKSDHKF
QTTGINEKQGAAWESGLDDSPMYDGVPFDPDRHIMLLEDIGLTGLYLNDCYCLAEIAEIL
GDLPGRQTLLERAAAIEDRLEGVWDEKTGLYLNRRADTGALQHRLSPFHFHALFSHRVEK
QCAERIVREHLCNPEEFWTPYILPSIARSDPAYPDQVYFRGRALPPMNLLTYLAVCGYGF
DDVERGLAEKSVELILKEWLEKGHVHETYDPETGEGCKPGFSDPFYHWGGLLSFVALHYY
GYYNG

Enzyme Prediction     

No EC number prediction in MGYG000003911_01309.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.13e-16	249	605	350	782	alpha-glucosidase; Provisional
COG3408	GDB1	1.15e-06	162	579	212	591	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PLN02567	PLN02567	2.94e-06	281	452	189	381	alpha,alpha-trehalase
pfam01204	Trehalase	8.69e-05	249	574	131	478	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	8.29e-04	246	604	172	553	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58860.1	4.92e-202	1	597	15	612
QTH44429.1	1.97e-193	4	597	17	611
QNI32096.1	3.24e-164	8	598	2	599
QRQ47302.1	6.74e-161	4	597	31	626
QUT46474.1	6.74e-161	4	597	31	626

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	5.85e-12	223	582	296	743	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.33e-11	223	582	296	743	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.07e-11	223	582	296	743	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.22e-10	223	582	297	744	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7T66_A	2.37e-08	319	578	535	796	ChainA, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T66_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	3.26e-11	223	582	319	766	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003911_01309.