CAZyme Information: MGYG000003912_00523

Basic Information

• Species: Prevotella sp000435635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000435635
• CAZyme ID: MGYG000003912_00523
• CAZy Family: GT26
• CAZyme Description: UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,4-galactosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237		27371.81	9.3213

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003912	2374877	MAG	China	Asia

• Gene Location: Start: 229795; End: 230508 Strand: +

Full Sequence      

MKSILVNKIIKTDTLSSILMMETRGKVYTFLNPVSYLCALDNKDIFARFDGIFADGSILV
SAIRLLYGQSVKRRSFDMTSLAPVWLKYAEEKRKSVYIVASKQEQVERSVEIFKERYPGL
IVAGYRNGYFASDDEQQCEANHIVEVRPDFLIVGMGALMQEQFLLKVKDAGFDGIGFTCG
GFIHQTAKDEIDYYPGWVDRMNLRFLYRMYKEKHTRKRYLQAALLFPARFIAERLFG

Enzyme Prediction     

No EC number prediction in MGYG000003912_00523.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	47	214	3.7e-37	0.9532163742690059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06533	Glyco_transf_WecG_TagA	1.68e-48	46	219	1	171	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
pfam03808	Glyco_tran_WecB	2.15e-43	52	219	4	169	Glycosyl transferase WecB/TagA/CpsF family.
COG1922	WecG	9.91e-29	29	235	42	249	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY44233.1	9.98e-119	1	237	1	237
QUT57815.1	9.98e-119	1	237	1	237
QQY36825.1	2.01e-118	1	237	1	237
ABR41066.1	2.01e-118	1	237	1	237
AII63519.1	2.86e-118	1	237	1	237

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5L3X1	2.66e-38	7	235	4	229	UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,4-galactosyltransferase OS=Shigella boydii OX=621 GN=wfeD PE=1 SV=1
Q8RKI7	4.06e-10	22	209	30	214	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarA PE=3 SV=1
Q2G2L3	5.24e-06	52	208	72	222	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarA PE=1 SV=1
Q5HI32	5.24e-06	52	208	72	222	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=tarA PE=3 SV=1
Q6GBJ4	5.24e-06	52	208	72	222	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=tarA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003912_00523.