CAZyme Information: MGYG000003912_01562

Basic Information

• Species: Prevotella sp000435635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000435635
• CAZyme ID: MGYG000003912_01562
• CAZy Family: GH67
• CAZyme Description: Extracellular xylan exo-alpha-(1->2)-glucuronosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655	MGYG000003912_12|CGC1	75175.24	6.2514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003912	2374877	MAG	China	Asia

• Gene Location: Start: 25291; End: 27258 Strand: +

Full Sequence      

MKKLFLLGIMLMTFTLSWADDGSRLWLPSQAMNKEAAKVKVACKQKSAILESAKEELRQG
WKWSEKVTLAVEKNAGNEEVYHIILYRGKNGQPLATVKGASDRAVLYGVYELLRLQETGQ
LKKLSVDKVNGEAVLFDKTYQPAFPLRVLNHWDNLDGSIERGYAGKSIFWSCPSDRKVWK
EHIRQYARANASIGINGSVLNNVNASPKMLTADYIDSVRMIADILRPYGIKAYLSINFGT
PKALGETETADPLDPAVRNWWKEKVKELYKEVPDFGGFLVKANSEGQPGPFDYDRTHADG
ANMLSEALRPYGGIVMWRSFVYGARHKGEDRVKQAVSEFHDLDGKFADNVLLQSKNGPLD
FQPREPYAPIFDQMKATDQMVEFQITQEYLGQSKHLVYLAPMWKEFFTYIEPGLLRGIAG
VSNVGMDANWCGHDFSQANWYAYGRLAWNPALTAEEIAKEWLTQTYTDDSAFLAEMEDVM
MDSREACVDYMMPLGLHHIFKFDHHYGPEPEGFKAEYPLEWCPVYYHKADSLGIGFDRTV
ATGSGATSQYRAPFASLYDNLETCPEEFLLWFHRVPWNYVMRDGKTLWQNLRTRYQRGVN
EVRRFSDTWQRMKPYGDEERWAHTNNLLQTQIRDAEEWRDVCLGYFGSFVPEEQR

Enzyme Prediction     

EC	3.2.1.139	3.2.1.131	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH67	51	649	7.6e-246	0.8998505231689088

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3661	AguA2	0.0	16	646	1	667	Alpha-glucuronidase [Carbohydrate transport and metabolism].
pfam07488	Glyco_hydro_67M	0.0	137	429	12	324	Glycosyl hydrolase family 67 middle domain. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the central catalytic domain of alpha-glucuronidase.
pfam07477	Glyco_hydro_67C	1.57e-120	431	649	1	213	Glycosyl hydrolase family 67 C-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the C terminal region of alpha-glucuronidase which is mainly alpha-helical. It wraps around the catalytic domain (pfam07488), making additional interactions both with the N-terminal domain (pfam03648) of its parent monomer and also forming the majority of the dimer-surface with the equivalent C-terminal domain of the other monomer of the dimer.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67391.1	2.09e-288	2	649	3	661
BCS85458.1	3.12e-287	1	652	1	624
CCG34756.1	3.97e-287	1	653	1	640
ADI70674.1	5.72e-281	1	649	1	623
AGB29054.1	7.22e-272	11	649	10	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQI_A	1.98e-182	90	648	105	665	Structureof Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQI_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQJ_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQJ_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQK_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQK_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQL_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus],1GQL_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus]
1H41_A	1.59e-181	90	648	105	665	Pseudomonascellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus],1H41_B Pseudomonas cellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus]
1MQP_A	3.73e-175	99	646	108	663	TheCrystal Structure Of Alpha-D-Glucuronidase From Bacillus Stearothermophilus T-6 [Geobacillus stearothermophilus]
1MQR_A	1.05e-174	99	646	108	663	ChainA, ALPHA-D-GLUCURONIDASE [Geobacillus stearothermophilus]
1K9D_A	1.49e-174	99	646	108	663	The1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1 [Geobacillus stearothermophilus],1L8N_A The 1.5A crystal structure of alpha-D-glucuronidase from Bacillus stearothermophilus T-1, complexed with 4-O-methyl-glucuronic acid and xylotriose [Geobacillus stearothermophilus],1MQQ_A THE CRYSTAL STRUCTURE OF ALPHA-D-GLUCURONIDASE FROM BACILLUS STEAROTHERMOPHILUS T-1 COMPLEXED WITH GLUCURONIC ACID [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3PC73	2.31e-181	90	648	129	689	Extracellular xylan exo-alpha-(1->2)-glucuronosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=gla67A PE=1 SV=1
Q09LY5	2.04e-174	99	646	108	663	Xylan alpha-(1->2)-glucuronosidase OS=Geobacillus stearothermophilus OX=1422 GN=aguA PE=1 SV=1
P96105	1.83e-165	90	654	96	668	Xylan alpha-(1->2)-glucuronosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aguA PE=1 SV=2
B0Y2K1	5.01e-139	97	655	126	692	Probable alpha-glucuronidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=aguA PE=3 SV=1
Q4WW45	5.01e-139	97	655	126	692	Probable alpha-glucuronidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=aguA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000327	0.998931	0.000231	0.000163	0.000162	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003912_01562.