CAZyme Information: MGYG000003912_01899

Basic Information

• Species: Prevotella sp000435635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000435635
• CAZyme ID: MGYG000003912_01899
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433	MGYG000003912_19|CGC1	49509.66	4.941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003912	2374877	MAG	China	Asia

• Gene Location: Start: 12000; End: 13301 Strand: +

Full Sequence      

MMRKILFTMLALAAVLPTLSQERFVGGDISLLPSYVENGAEYYDHQGQPIADPLAFFQQQ
GMNAMRVRLFVDPSQAPEQEKGEGVRQDLEYVKRLGKQIKDAGMKLMLDFHYSDSWADPG
KQFTPQDWVALDDGQLAERVHDYTRDVLREMKAYGAEPDFIQTGNEISYGMMWGERGAAE
ENLLHCWPSSPEANWARFTRLLVQATKACREECPQAKIVLHVERVSTSQQKDNQDYAALK
NFYSQMAAAQIDYDIIGLSYYPYFHGTMEELEGAIQCLEQAYPEKDIMLVEAGYCAHDAI
SGTFDYTYKYPISDQGQGNFTRDLIAMLKRHERVTGLFWWFMEANEHGLDWNTERVTDAW
YNASLFDNHTGRATSALSLLKDFLERSSTDMAQVETLQSQNKNNHWYTLDGKRLPSAPTT
KGLYIHNGNKVVR

Enzyme Prediction     

EC	3.2.1.89

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	26	378	2.8e-91	0.9853801169590644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	3.64e-80	25	380	2	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	5.23e-73	26	368	42	374	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE83762.1	2.30e-138	10	431	6	413
VEH14955.1	9.40e-136	15	385	39	399
QVJ80245.1	2.26e-108	10	431	6	420
QUT66820.1	2.84e-106	1	385	1	365
AGB28452.1	1.00e-100	4	433	5	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	7.21e-53	17	395	44	406	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	2.12e-38	26	340	27	320	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	1.50e-37	26	340	27	320	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
4BF7_A	3.17e-29	5	340	2	313	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJS_A	8.01e-29	39	340	19	296	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.28e-48	19	388	1	354	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q65CX5	1.83e-37	26	340	52	345	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
A1D3T4	2.45e-34	26	340	27	319	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
O07013	4.65e-34	26	340	56	349	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
Q4WJ80	8.99e-34	26	340	27	319	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000403	0.998752	0.000292	0.000181	0.000177	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003912_01899.