CAZyme Information: MGYG000003912_02004

Basic Information

• Species: Prevotella sp000435635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000435635
• CAZyme ID: MGYG000003912_02004
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000003912_24|CGC1	42881.76	6.7227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003912	2374877	MAG	China	Asia

• Gene Location: Start: 9245; End: 10387 Strand: -

Full Sequence      

MKYYIIVGEASGDLHASHLMSALKAEDPEAEFRFLGGDLMSAEGGTRVKHYKELAYMGFV
PVLLHLPTIFRNMAMCKKDIAAWRPDVVILVDYPGFNLSIAKYAKKHTGIPVYYYISPKV
WAWKEWRVKSIKRDVREMFSILPFEVPFYQDKHKYPIHYVGNPTVQEVAEFKENYREGYE
DFCAGNGLEPDRPIIALLAGSRKQEIKDNLPAMIEAAERFEDYQLAVAGAPAIDDAYYEK
FISGKPVTLVRNKTYPLLAHSAAALVTSGTATLETALFDVPQVVCYETPLPKLIRFAFDH
IIQVRYISLVNLIADKEIVPEMLADKFTVDGIATELHRVLPGGEGRDAMLEAYREVKAKL
GDMCAPVRAAHIMVGLLRDR

Enzyme Prediction     

No EC number prediction in MGYG000003912_02004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	360	1.1e-116	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.51e-107	1	380	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.07e-99	1	378	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.63e-74	4	346	2	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.04e-64	5	370	10	379	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.24e-49	1	332	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66516.1	6.24e-202	1	380	1	380
QUB72247.1	2.19e-197	1	380	1	379
QUB84094.1	3.81e-197	1	380	1	379
QUB87398.1	4.62e-197	1	379	1	378
AKU68449.1	4.62e-197	1	379	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.66e-36	5	360	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.13e-36	5	360	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	6.59e-71	2	377	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	3.95e-66	2	377	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	8.60e-65	2	377	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2IL69	7.13e-63	5	378	13	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B3E4H8	2.80e-62	2	379	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003912_02004.