CAZyme Information: MGYG000003912_02053

Basic Information

• Species: Prevotella sp000435635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000435635
• CAZyme ID: MGYG000003912_02053
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		45572.51	9.2405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003912	2374877	MAG	China	Asia

• Gene Location: Start: 3211; End: 4410 Strand: -

Full Sequence      

MKLSVVIVNYNVRFYLEQCLRSVKKAIQGLQAEVWVVDNHSSDGSLEYLRPRFPWVNFVP
SLHNEGFSKANNLALRQCHGEYALLLNPDTIVAEDTLREALRFMEAHPDAGALGVRMLNP
DGTSAPESRRGIPSPMTAFYKLTGLCRHFPHHPRLGHYYMGGISWQEPHEIEVVSGAFCL
LRRTALSKVGFLDEDFFMYGEDIDLSYRLLRQGYHNYYLPALILHYKGESTRRSSFRHVH
VFHEAMLIFLRKHYAHFSFPLLAPLQLAIYLQALLALTRMGFARARHVLGFFPRKRRKSN
PLYIFLGRESSLNECRTLAQAHGLDAQFVEGSMETLPQGHLSRSLSLTPGKETFIVYDTE
AYPYSTILQLFAQAPKPKVALGTYDPSTKTLITPNEILR

Enzyme Prediction     

No EC number prediction in MGYG000003912_02053.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	189	5.4e-23	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.23e-53	5	226	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.28e-53	1	299	3	282	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	9.68e-23	4	226	1	193	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.45e-21	4	186	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06423	CESA_like	1.52e-21	16	202	12	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APW34445.1	2.60e-156	1	399	1	398
ATV39814.1	3.69e-156	1	399	1	398
ATV33776.1	3.69e-156	1	399	1	398
QYR10757.1	1.05e-155	1	398	1	397
ATV53967.1	6.04e-155	1	399	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	1.49e-09	1	128	1	131	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	2.22e-09	1	128	1	131	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	5.60e-22	3	286	5	296	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	5.60e-22	3	286	5	296	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
D4GU63	1.57e-12	3	212	20	209	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
A0A0H3JPC6	1.22e-08	1	128	2	132	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=tarS PE=1 SV=1
A0A0H3JVA1	1.22e-08	1	128	2	132	Poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase TarS OS=Staphylococcus aureus (strain MW2) OX=196620 GN=tarS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
255	277