CAZyme Information: MGYG000003916_00371

Basic Information

• Species: UMGS1474 sp900547105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1474; UMGS1474 sp900547105
• CAZyme ID: MGYG000003916_00371
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
793		85604.76	5.4949

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003916	2239460	MAG	China	Asia

• Gene Location: Start: 54725; End: 57106 Strand: +

Full Sequence      

MSCSPYPANMVPELAVLAREVAAEGAVLLKNDHRLLPLQNGRAVSVFGRCQYDYYKSGTG
SGGMVNAPYVVSLLDGLRQSPHIRLNEQLASVYTDWCRQNPPEHRAEWAADPWSQPEMPL
TEALVQQAAAFSDTALVVIGRTAGEDRDAANAEGSFLLSAGEREMLRLVTAHIPHVAVLL
NTGNILDMSWEDDYPVDAILYVWHGGMEGGNAAADVLTGVVPASGRLSDTIARRYADYPT
AAHFGGDDAVVYAEDIFVGYRYFETFAPERVRYPFGFGLGYTTFSTQAHAEIDGDQITVS
STVTNTGDAAGKEVVQVYAAAPQGTIGKPARVLVGFGKTRLLAPGDSQTLTIRFAAEQMV
SYDDSGKTGHRFAYVLEAGDYTLLSGSNVRDARPIGVFRQPAMRVVRQCEQALAPSPAHP
FERMIARQESGRLVPAQEPAPTRQQSTAERITHRLPAPLTPPEGPAPTFAQVCRGEATPE
AFVAALALPELAYLCRGEGMNSPKVTPGTASAFGGLTPALAATGLPVACCSDGPSGIRMD
TGTPATSLPIGTLMACTWDPALIERLHRLEGQELLLNRVDCWLSPGMNIHRHPLCGRNFE
YFSEDPLLTGMMAAAVVRGVQSVGVGATPKHFAANNQEHRRHDADSRVSERALREVYLKG
FEIVVKAAHPAAIMTSYNPINGRHSANAYDLTTTILRDEWGFDGMVMTDWWAKKETDGLL
KQEAAMIRAQNDIAMPVGSEESIVEAVQGGALTLGEVQRCAAHIVRLLARLPVSRDYRPG
SDSTPGHAPFEVD

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	523	736	1.1e-63	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.71e-49	521	785	56	329	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.28e-44	26	260	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	5.89e-36	18	386	387	751	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	1.60e-28	524	767	65	316	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	1.88e-17	546	764	118	349	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAM46899.1	1.04e-273	15	792	14	816
QCT02888.1	3.08e-267	5	773	9	808
AGA57213.1	3.40e-266	11	775	10	804
QKS45160.1	8.45e-265	11	773	12	799
QAY67269.1	1.99e-263	15	773	12	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	7.83e-261	15	779	37	831	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	6.54e-61	486	778	11	314	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	8.07e-60	486	778	11	314	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	1.05e-53	524	768	36	286	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.59e-49	522	768	34	285	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	9.34e-238	18	768	13	762	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	1.65e-164	17	759	31	812	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P14002	5.76e-53	524	768	36	286	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	2.00e-52	524	768	36	285	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	6.78e-52	524	768	36	285	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003916_00371.