CAZyme Information: MGYG000003916_00401

Basic Information

• Species: UMGS1474 sp900547105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1474; UMGS1474 sp900547105
• CAZyme ID: MGYG000003916_00401
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474		53524.9	5.774

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003916	2239460	MAG	China	Asia

• Gene Location: Start: 96956; End: 98380 Strand: -

Full Sequence      

MKVLYATSEALPFAASGGLADVAGSLPQALRRRLVGCRVVLPLYESVPQELRDQMTFLTS
LSVPVAWRRQYCGVFEARQNGVIYYLLDNQYYFKRAGLYGHYDDAERFAFFARAVLEMLP
AIGFMPDVIHANDWQTALIPVYHHLYYADRPEYSSIKTVYTIHNIQYQGRYGTDILEDVF
GIPRSAQSLLEQDGDLNLMKGAIETANRVTTVSPTYAQEIMDPWYAHGLDSILRARSWKV
SGILNGIDTEAYDPATDPQIPVHYSADDFSGKAGNKQALQERLGLSQQPDVPLIGMVTRL
VSHKGLDLVKYILDELLHENVQMVVLGSGDWQYESFFKEMQERYRDKFCYCSGFVPELAH
KIYAAADIFLMPSKSEPCGLAQMVACRYGTLPVVRETGGLKDSIHDCGDGTGNGFTFQTY
NANDMLYAIHRALGAYANKTDWPVLVERAMRCDFSWGRSANEYIRLYKELIKGE

Enzyme Prediction     

No EC number prediction in MGYG000003916_00401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	468	7.1e-179	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	469	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	1	472	1	465	glycogen synthase GlgA.
COG0297	GlgA	0.0	1	471	1	479	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	1	470	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK14099	PRK14099	4.18e-123	1	471	4	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEY34691.1	3.45e-259	1	472	1	473
QNO18264.1	6.47e-259	1	472	1	473
ARP51332.1	1.85e-258	1	472	1	473
QKN23272.1	1.85e-258	1	472	1	473
QKO30046.1	1.85e-258	1	472	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	6.45e-94	1	471	10	498	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
2QZS_A	1.28e-90	1	470	1	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	9.98e-90	1	470	1	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
3D1J_A	1.58e-89	1	470	1	476	ChainA, Glycogen synthase [Escherichia coli]
4HLN_A	4.84e-82	2	468	126	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4IS20	6.95e-171	1	474	1	478	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	2.80e-170	1	474	1	478	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
B7GK04	2.70e-165	1	473	1	477	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
Q72YJ6	4.74e-164	1	472	1	476	Glycogen synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=glgA PE=3 SV=1
B7HBC4	6.72e-164	1	472	1	476	Glycogen synthase OS=Bacillus cereus (strain B4264) OX=405532 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003916_00401.