CAZyme Information: MGYG000003916_01192

Basic Information

• Species: UMGS1474 sp900547105
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1474; UMGS1474 sp900547105
• CAZyme ID: MGYG000003916_01192
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
202		23099.22	4.7866

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003916	2239460	MAG	China	Asia

• Gene Location: Start: 7354; End: 7962 Strand: +

Full Sequence      

MTKAQKQQQKKRRVRAAILIVIVLAVVTTVCVLALHKGYDHFSKTVYPLPYREYVEKYAA
EYGEDPSLVYAVMSTESSFDAEAVSSAGAMGLMQLTDKTFEWAQMRMGTQDKGLTDDDLF
KPEINIQYGTYVLHLLREDFDRTATLLAAYNAGRSNVLEWLENSDYSQDGETLVDIPLSE
TRQYVLKVLQTQERYQQLYDIP

Enzyme Prediction     

No EC number prediction in MGYG000003916_01192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	62	195	8.9e-27	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.15e-68	48	194	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.04e-44	47	198	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16893	LT_MltC_MltE	4.02e-32	53	193	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
cd00254	LT-like	6.14e-32	66	190	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	8.50e-32	43	199	131	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK41497.1	7.17e-51	33	201	25	190
QAT49510.1	1.09e-49	32	201	22	188
CDZ23581.1	1.14e-47	38	199	28	188
QNO16977.1	6.35e-45	30	199	38	208
QCN93454.1	8.17e-45	40	199	31	189

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	1.39e-11	40	195	165	338	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
5O1J_A	1.86e-11	47	202	416	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.86e-11	47	202	412	562	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O24_A	1.87e-11	47	202	426	576	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.87e-11	47	202	422	572	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2K0V2	5.75e-13	40	195	182	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=mltC PE=3 SV=1
A8GJ50	5.75e-13	40	195	182	355	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1
A9R6R2	5.75e-13	40	195	182	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=mltC PE=3 SV=1
Q666M2	5.75e-13	40	195	182	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=mltC PE=3 SV=2
Q1CEV1	5.75e-13	40	195	182	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.978630	0.013042	0.004780	0.000105	0.000061	0.003413

TMHMM  Annotations     

start	end
13	35