CAZyme Information: MGYG000003921_01202

Basic Information

• Species: Gemmiger sp900540595
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900540595
• CAZyme ID: MGYG000003921_01202
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626	MGYG000003921_11|CGC1	70330.31	6.1264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003921	2675268	MAG	China	Asia

• Gene Location: Start: 38869; End: 40749 Strand: +

Full Sequence      

MPETSNKKPDNERPADLAIQDSVGGMARRLLNPAHLRDLAGRSVKTLREQGAEQLWRDVK
FRVGLALHHDDWRHRADLPLRRELKAQRAAALQGPQISIIVPLYNTPAKFFDEMLNSVIR
QTYTNWELVLLDASDADKRLESRLPKAVPGVIVYEPIENGGIAANTTRGFALAHGDFIAL
LDHDDVLYPNALFEVVQTLQSTGADFVYSDEIVLSADLKQLGGYHFKPDFAPDYLRGVNF
ITHLAVFSRPLLDAAGAYESKEFDGAQDHDLILRLTEKAQRIEHIKKVLYIWRGHAGSTA
AGMEAKPYAVAAGERAIDAQLQRLGLPGHAMAVPDAPGAFQVRYELTGHPKISVLIPNKD
HTDDLDRCLTSLYKNAGYDNFEVIVIENNSTDPATFAYYKTLHDKFPTCWVVTFEGHGPF
NFSAINNFGASFAEGEHLLLLNNDIEVLSSDFLRELLSYSQRPDVGAVGAKLYYPDDTIQ
HAGVLMGINGSAGHSHKSYPRTAVGDMYRLVTTQDYMAVTGACLMTKTALYRECGGLDEE
KFAVAYNDVDYCLKLWQKGLLNVYTPRAEAYHYESKSRGLDTLSENARRYEREKANFYAK
YQQYIDNYDPYYNPHFNNLFENFGLK

Enzyme Prediction     

No EC number prediction in MGYG000003921_01202.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	98	208	4.4e-20	0.6588235294117647
GT2	350	577	2.2e-18	0.9304347826086956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.40e-73	95	293	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	5.61e-39	354	574	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.32e-29	350	601	3	247	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	1.36e-23	98	299	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.56e-19	98	252	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22278.1	5.53e-164	96	611	97	614
CDM69534.1	5.60e-163	78	611	224	757
QMW89744.1	2.64e-161	96	626	84	615
BBK78193.1	2.64e-161	96	626	84	615
QNM02106.1	7.88e-161	95	611	116	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.14e-07	94	205	4	115	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.47e-113	94	593	365	866	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.90e-85	82	585	304	805	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
A0A0H2UR96	2.06e-09	97	207	5	116	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q92IF9	2.46e-09	97	199	16	117	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q4UM29	7.44e-09	85	199	4	117	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003921_01202.