CAZyme Information: MGYG000003922_00503

Basic Information

• Species: Bacteroides sp014385165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp014385165
• CAZyme ID: MGYG000003922_00503
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677	MGYG000003922_3|CGC3	77560.96	6.6182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003922	4876803	MAG	China	Asia

• Gene Location: Start: 141522; End: 143555 Strand: -

Full Sequence      

MRHKLLSLIIATGFCLTVSGSNPVKPQTTNYSNNRFPLIQKPFIELPLGSIKPKGWLQEM
LIRQKNGATGQMDQLYPQVMGTRNGWLGGDGDQWERGPYWIDGLLPLAYILDDRELKSKA
QPWIEWALQSQREDGFFGPAQDYPSEPGLQRNNSHDWWPRMVMLKILQQYYSATQDERVI
ALMTNYFRYQLKTLPEKPLGYYSFWAEYRACDNLQAVYWLYNITGDAFLLDLGDLLHKQS
FSFTNMVERGDLRKINTIHCVNLAQGIKEPVIYYQKNGDKQYLRSVKEAFRDIRQFHGQP
QGMYGGDEALHGNNPTQGSELCSAVELMYSLEKMMEITGDMDFADHLERVAFNALPTQAS
DDFMTKQYFQQPNQVMVTRHRRNFDQDHAGTDNVYGTLSGYPCCFSNMHQGWPKFTQSLW
YATPANGLAVMAYSPSEVTAKVGDSFTATISEETLYPMDDRIHFTIRDLRNAKKKESGAT
FPLQFRIPGWCKSAVIAVNGTPVQVEAGKRMAVIDREWKKGDRIEIHFPMEVSASTWYEN
SVAIERGPLVYALKMNENWKKTEVDESRFGSHYYNVTSDTPWNYGLVNFDRNKAAEHATV
KIDSEKQKAIYPWNLENAPVEIKMKARRIPSWGIYNEMAGPQPYSFCSGGEGPVEEITLI
PYGCTTLRISEFPMVGQ

Enzyme Prediction     

No EC number prediction in MGYG000003922_00503.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	316	552	2.8e-37	0.4312977099236641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	7.23e-63	99	552	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.60e-31	314	553	286	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP55412.1	4.18e-158	3	676	4	652
ARS39276.1	1.25e-155	15	677	14	650
ALL07583.1	5.51e-155	2	676	5	652
ACU60445.1	2.06e-154	1	676	2	652
QPH39723.1	2.82e-154	6	677	1	651

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.50e-22	100	558	82	566	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.27e-20	100	558	82	566	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	4.94e-18	90	554	100	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6EX6_A	1.10e-14	101	586	76	578	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
6YQH_AAA	2.71e-13	314	636	331	641	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.70e-09	314	558	332	572	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001478	0.966634	0.031173	0.000264	0.000224	0.000203

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003922_00503.