CAZyme Information: MGYG000003922_03809

Basic Information

• Species: Bacteroides sp014385165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp014385165
• CAZyme ID: MGYG000003922_03809
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000003922_131|CGC1	43193.74	7.9467

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003922	4876803	MAG	China	Asia

• Gene Location: Start: 2678; End: 3778 Strand: -

Full Sequence      

MKKELLFTWMLFISCIAYAQDFIHATYLVGNSLKDVEKVKQIDYSQFQYIYLMAAPQWNQ
EDFGQPQENIIKHLVSDHQYAKDQGIEIVPLLIEEAHKNKTKVLLSFAGAGFNEIVSSIE
KQKKFIDMMIRFIDKYNYDGIEIDWEQDLSLPLHAEFISNIRLKLDDLEKKRNDSKHLYL
TTALHSWQVYHKELANKLASNVDWINIMTYDMGGGIWGNVPEHNTPLNKMEKELKNWKVF
NRNKLCIGLANYGFIYKDLSPGIKIEGKLDKNGKYFSYNNMLPLLQKGWVEQYDKKAKVS
YYFSPDKSEFITMENPKTILTKIQWITKEKYRGAFWWEFNYDIIYPTTQTGKIRHHLIDV
VSKYLD

Enzyme Prediction     

No EC number prediction in MGYG000003922_03809.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	56	343	2.8e-50	0.9155405405405406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	1.75e-42	96	342	62	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	6.02e-38	96	342	59	307	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	6.03e-37	102	342	86	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
COG3325	ChiA	5.10e-31	102	342	128	423	Chitinase, GH18 family [Carbohydrate transport and metabolism].
cd02872	GH18_chitolectin_chitotriosidase	3.68e-28	100	337	70	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61687.1	1.89e-160	19	362	20	361
QRO25976.1	1.41e-143	17	362	18	361
QHI70666.1	1.49e-108	22	363	31	374
BBL10471.1	4.77e-107	21	365	29	371
BBL13265.1	4.77e-107	21	365	29	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KST_A	3.00e-22	104	342	79	357	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	3.00e-22	104	342	79	357	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	1.42e-21	104	342	79	357	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
1LG1_A	6.34e-19	100	342	68	342	CrystalStructure Of Human Chitotriosidase In Complex With Chitobiose [Homo sapiens],1LG2_A Crystal Structure Of Human Chitotriosidase In Complex With Ethylene Glycol [Homo sapiens],1LQ0_A Crystal Structure Of Human Chitotriosidase At 2.2 Angstrom Resolution [Homo sapiens],6ZE8_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_B Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_C Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_D Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_E Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_F Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens]
1GUV_A	6.40e-19	100	342	68	342	Structureof human chitotriosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q06350	2.34e-18	100	338	173	448	Sporulation-specific chitinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS2 PE=1 SV=1
Q13231	6.61e-18	100	342	89	363	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
Q95M17	7.27e-17	99	342	88	365	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
P29030	7.98e-17	102	366	99	390	Endochitinase OS=Brugia malayi OX=6279 PE=1 SV=1
P20533	1.04e-16	102	342	156	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002666	0.995296	0.001314	0.000234	0.000228	0.000242

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003922_03809.