CAZyme Information: MGYG000003925_01540

Basic Information

• Species: CAG-882 sp900545175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp900545175
• CAZyme ID: MGYG000003925_01540
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000003925_16|CGC1	35887.88	4.5468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003925	3268447	MAG	China	Asia

• Gene Location: Start: 45979; End: 46938 Strand: +

Full Sequence      

MDTITIKVDPSGKGDFTTINDALDSVEAVNDNIPVRIELAPGEYYERLEIIRPHVTLAGD
DPDNTFITHSLYALMLMEDGTKRGTFRSYSVFVDADDFTAENITFENASGDGRDVGQAIA
VYSEGDMVKYINCCFLGCQDTLFTGPLPPKELQPGGFIGPKQFAPRINGRQYYKDCFIRG
DIDFIFGSSTAYFENCEIFSNNRGEKVNGYVTAPSTPEGQEYGYIFDGCHFTSNCPPESV
YLGRPWREYAKAVFLNCEMDAHIKHEGFHDWNKEITHKTAFWAEYNNTGEGAKGERAPWV
HRLTDEEAAHYSRKNVLGF

Enzyme Prediction     

No EC number prediction in MGYG000003925_01540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	6	317	2e-94	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	4.65e-85	15	317	93	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	1.36e-69	1	311	2	290	pectinesterase
PLN02432	PLN02432	1.12e-60	1	318	8	287	putative pectinesterase
pfam01095	Pectinesterase	5.19e-60	8	318	4	296	Pectinesterase.
PLN02682	PLN02682	6.07e-55	3	308	68	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	6.30e-130	6	317	2	313
ABX41678.1	2.40e-123	3	317	4	331
ACZ98654.1	2.61e-123	4	317	2	313
ADZ82949.1	3.61e-122	11	317	6	312
QEH68466.1	4.81e-120	11	317	6	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	2.46e-35	6	273	35	305	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	4.36e-35	16	318	18	335	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	7.64e-31	14	292	17	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.48e-30	14	292	17	266	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1QJV_A	3.34e-29	16	318	18	335	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	8.23e-56	3	311	4	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8L7Q7	4.55e-42	16	317	301	592	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q8GXA1	1.57e-41	12	317	264	551	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8VYZ3	1.20e-39	11	308	91	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9LXD9	1.68e-39	6	317	241	541	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003925_01540.