CAZyme Information: MGYG000003926_00121

Basic Information

• Species: Rikenella microfusus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Rikenella; Rikenella microfusus
• CAZyme ID: MGYG000003926_00121
• CAZy Family: GH101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1143		128484.34	6.5921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003926	2402156	MAG	China	Asia

• Gene Location: Start: 14286; End: 17717 Strand: +

Full Sequence      

MIRYFSRIAAVAALSVAPFGAAAFSSGAWTVVRSEKQTSFLTRGDTLQLWAAGDLMVVDT
SVRACRNMSLEFTVVPENEKSHIGALVRYVSPDDWIYVGCDLTTDIFGYCYWYVETPQGR
KQVATDIAKLYKNYPRRIQVDCGDEAILLRVDGEKVAHFALPWRGYDRPGRVGFRVWDGG
AAKIYDVEVVDNGPAGGEGMVRMDEEVAARSHKLSVSLVRGFPVDYSWHRNGGMSSGNWS
SPFWIINGKRYRAEDLVQDDVRVDDSTYTYKYGFPQIGIEIDVENSVRGNVYEWRVTDIR
EKGDFRVRTIGLGDNMLIAMPNADTTARLSVAWNEGGDGFWKLSERTKTDTVPVPAAIAI
LNNDKVAVASDNNSQYESKQFLIRNRSERTSIGSNEWIYRGPDGKVTELPYQKVIFADDI
NGDGKVTWQDGAVALAEVYPDPYGAEMVRNSNVTITMNFASEGQYPFLRQLDNIKKIYYL
TDGFGQMLELKGYQSEGHDSGHPDYAGHYNERAGGLKDLRVLIDEAKKYNAHIGFHINHS
ESYPEARAFDDTIVTRIPGWKWLDQAYLINKEADHLNGSFAKRLNDLHRDLPGLAFIYLD
TYREHRYWAYRTAKMFNERGWTVWTEDPSVFNRYGTWIHYNPESNSLISRFVHNHRKDAF
GADSLFPGGYGRGADVGFQGWQSGRDMNLAIKNFYTKQLPLRYVMHFPVIYADSVAARFR
GGVETRRAAGVTTMYRDERKVMDGEVVFIPWNPLTEEKVYHYNPAGGVTEWEVPESWEEV
RAAYLYRLTDRGRVAVGRVAVKEGRVSLTAEAGVPYVLYRDTPPKLLPADWSRGSAVRDM
GFDSRSFGWWKPIGARKGVGFETTLYGQSVLKLTGRKACGAAQEIAGLDPEKYYHLSVWV
QVDGEREASMRAVTPSGGRAVSVRRTDIPTFVENTDKKGTRYQRLEMRLHGVEAFSLVLC
AGKSVSDTTAVRFDDVRLMEVSTPTSGSLAAQAEGYLYYEDFERVPFGWGPFMLSRPSNC
TSHLSKRHDPYTAGDVINGDWSFKTLNEGGGEILRTMPSLLSFSPNTGYAVEFEYDAPVA
GVYRGVVRSAKTGRTLVSEPLDGRGRFAAEFVTDGADDYYFSVVKAGEGMLVIDDFGVRK
TGK

Enzyme Prediction     

No EC number prediction in MGYG000003926_00121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	215	710	1.2e-96	0.7821782178217822

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12905	Glyco_hydro_101	3.42e-92	429	691	1	273	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
cd14244	GH_101_like	3.71e-83	441	710	1	294	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam18080	Gal_mutarotas_3	6.25e-33	210	428	2	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	2.92e-20	699	794	3	111	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.
pfam17974	GalBD_like	1.36e-13	974	1101	1	141	Galactose-binding domain-like. Proteins containing a galactose-binding domain-like fold can be found in several different protein families, in both eukaryotes and prokaryotes. The common function of these domains is to bind to specific ligands, such as cell-surface-attached carbohydrate substrates for galactose oxidase and sialidase, phospholipids on the outer side of the mammalian cell membrane for coagulation factor Va, membrane-anchored ephrin for the Eph family of receptor tyrosine kinases, and a complex of broken single-stranded DNA and DNA polymerase beta for XRCC1. The structure of the galactose-binding domain-like members consists of a beta-sandwich, in which the strands making up the sheets exhibit a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP57185.1	4.20e-305	52	1138	63	1130
AZN39795.1	3.34e-248	26	1143	13	1152
QHW33475.1	3.07e-242	72	1138	68	1207
AQT69519.1	2.99e-200	210	1087	52	928
AQT68159.1	1.78e-182	205	1138	24	980

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QFO_A	1.11e-93	210	1123	13	1081	EngBFDARPin Fusion 9b 3G124 [Bifidobacterium longum]
6QEP_A	1.41e-93	210	1123	13	1081	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
6QFK_A	1.45e-93	210	1123	13	1081	EngBFDARPin Fusion 4b G10 [Bifidobacterium longum]
6QEV_B	1.45e-93	210	1123	13	1081	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
6SH9_B	1.45e-93	210	1123	13	1081	EngBFDARPin Fusion 4b D12 [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9WNA0	1.97e-120	278	1083	122	971	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
Q8DR60	1.47e-87	392	1087	544	1332	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1
Q2MGH6	6.34e-87	392	1087	544	1332	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000580	0.998518	0.000200	0.000277	0.000215	0.000194

TMHMM  Annotations     

start	end
9	31