CAZyme Information: MGYG000003926_00631

Basic Information

• Species: Rikenella microfusus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Rikenella; Rikenella microfusus
• CAZyme ID: MGYG000003926_00631
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576		64424.32	6.8685

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003926	2402156	MAG	China	Asia

• Gene Location: Start: 2905; End: 4635 Strand: +

Full Sequence      

MKKIGLWLWAVCLCTAAHGAGKIRAEVARQPRTFCNPVDLPYRFMLIPEGKGAREAADPV
VVPFGGRYYLFASKSGGYWHTADFAQWTYVPIPDSVLPIEDYAPALFERGGWLYYAGSVP
GDATLYRSKAPERGEWEAVARIPSRWDPAFWVEGDDLYVYYGSSPVDPIRMVTLDANTFR
PKAAPQDCFDSDTSVHGWERPGARHELKRRPYIEGAWMTKHDGKYYLQYAAPGTEWDTYA
DGVYLGDSPVGPWRYMPNSPTSAKEGGFIGGAGHGCLFEVEGRWWKAATNSISVKHMFER
RVSFYPSGFDADGYLRTDTYRGDYPMWLPGGSRDGTAGPRWELLSLHRPVRVSSAWDGHG
GMLAADENVRTEWVARSAGADEWLEIDLGPGCRVAAVQVNFGEFGSALTARDARPRQSYV
LEASHDGQRWYTVVDNNEKTTDTPHDYIEFRKPFRARYLRIRNVKYTVSPCFSLRDLRVF
GFRRGEAPGAVDDLAVVRDREDDCRAALRWSPVPGADGYVVRYGIAPDKLYGSIRIPDGR
ADGWEMTGLNSGVPYWFAADVFNGSGTVRGKPVAAP

Enzyme Prediction     

No EC number prediction in MGYG000003926_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	56	313	8.7e-94	0.9961832061068703
CBM32	353	465	1.1e-18	0.7983870967741935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08982	GH43-like	3.57e-129	52	354	1	308	Glycosyl hydrolase family 43 protein; uncharacterized. This glycosyl hydrolase family 43 (GH43)-like subfamily includes uncharacterized enzymes similar to those with beta-1,4-xylosidase (xylan 1,4-beta-xylosidase; EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanase and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd08978	GH_F	1.16e-15	57	264	1	222	Glycosyl hydrolase families 43 and 62 form CAZY clan GH-F. This glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) includes family 43 (GH43) and 62 (GH62). GH43 includes enzymes with beta-xylosidase (EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanases (beta-xylanases) and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. GH62 includes enzymes characterized as arabinofuranosidases (alpha-L-arabinofuranosidases; EC 3.2.1.55) that specifically cleave either alpha-1,2 or alpha-1,3-L-arabinofuranose side chains from xylans. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. GH62 are also predicted to be inverting enzymes. A common structural feature of both, GH43 and GH62 enzymes, is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
pfam00754	F5_F8_type_C	7.27e-15	349	475	1	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam04616	Glyco_hydro_43	1.31e-12	57	260	11	221	Glycosyl hydrolases family 43. The glycosyl hydrolase family 43 contains members that are arabinanases. Arabinanases hydrolyze the alpha-1,5-linked L-arabinofuranoside backbone of plant cell wall arabinans. The structure of arabinanase Arb43A from Cellvibrio japonicus reveals a five-bladed beta-propeller fold. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd08999	GH43_ABN-like	6.54e-12	57	260	9	229	Glycosyl hydrolase family 43 protein such as endo-alpha-L-arabinanase. This glycosyl hydrolase family 43 (GH43) subgroup includes mostly enzymes with alpha-L-arabinofuranosidase (ABF; EC 3.2.1.55) and endo-alpha-L-arabinanase (ABN; EC 3.2.1.99) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. The GH43 ABN enzymes hydrolyze alpha-1,5-L-arabinofuranoside linkages while the ABF enzymes cleave arabinose side chains so that the combined actions of these two enzymes reduce arabinan to L-arabinose and/or arabinooligosaccharides. These arabinan-degrading enzymes are important in the food industry for efficient production of L-arabinose from agricultural waste; L-arabinose is often used as a bioactive sweetener. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY89859.1	1.39e-154	25	570	31	578
QEC77560.1	3.23e-150	10	573	21	586
BBE16007.1	1.24e-148	33	573	30	570
QIA09145.1	6.12e-145	1	573	1	575
ADQ81046.1	1.39e-144	32	570	29	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A8C_A	5.38e-08	54	316	35	315	ChainA, CARBOHYDRATE BINDING FAMILY 6 [Acetivibrio thermocellus],5A8D_A Chain A, CARBOHYDRATE BINDING FAMILY 6 [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49943	5.11e-06	147	317	137	319	Xylosidase/arabinosidase OS=Bacteroides ovatus OX=28116 GN=xsa PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000405	0.998904	0.000187	0.000173	0.000154	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003926_00631.