CAZyme Information: MGYG000003926_00737

Basic Information

• Species: Rikenella microfusus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Rikenella; Rikenella microfusus
• CAZyme ID: MGYG000003926_00737
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
905	MGYG000003926_62|CGC1	102969.28	5.0543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003926	2402156	MAG	China	Asia

• Gene Location: Start: 1562; End: 4279 Strand: -

Full Sequence      

MFQRNLYRMKRHLLYSLAGVALALASCGPQDAAKLLSEQPQRRTQILTEGWAFREADIPD
TAHRDLSVEKTVPDWTPATVPGVVHTDLLANGLIPEPFAGTTEPDLQWIGRRTWEYRTQF
APSPEITAQQVQELVFKGLDTYADVYLNDSLVLGGTDNMFVEWRIPVKGILRPDTLNTLR
IVFHPAYETALPEAQAWPVKLPNDNDKGEWVTSVFTRKAPYHFGWDWGPRYLTAGVWRPV
YLDAYSAAAIDHIQFVRGRQDSVQADFTARVTLAVQDAAPVRVILADSTGKTVYGRKDVV
PTDGTTTVDVPFSIANPELWWPNGLGEAHLYTVNTLITDKTGRLLDRNTQRIGVRTIRLV
QEPDSVGEGESFQFYVNGVPCFIKGANYIPQDAFLPRVDTARYEELIGTAVASNMNMLRI
WGGGIYEEDLFYDLCDEQGMMVWEDFMFACAFYPWDTAFLDNVRREAVYNVRRLRNHPSL
AIWCGNNEIDEAWHHWGYQKAYGWTPQEQAMVKHGIDTIFRGVLADVVAAEDSGRQYRPS
SPMYGRGNPLSQIKGDVHYWGVFHDEEPFSVYKDKPGRFSNEYGFVSLPCYDTYREYFRP
DEMWLYSPAMILHQKTPKGYRLLEEYMARDLPLLKDDFRTYVYLSQLIQAEGIKIAMEGQ
RSKRPFNQGTMYWQLNDCYPAISWSSMDSRYRWKALQYYAVRSFAPTLLSFERVDSTATA
VLWAITDRLAPQSGEVSLRLQDFAGKALWDTTLQAEVPANDNRELLRRADAELLRGADPR
ETYLVAEGVVGGDTLRSLYWFVPLKDLNLPKADYSVSYRQTGPRSVEATLTAHNLLKSVL
FEAEALQDNPSDAYFDLLPGEQRTIVLNFTEEIPTAGTDALGLSVRTLNDLAGRKSERPV
TENVR

Enzyme Prediction     

No EC number prediction in MGYG000003926_00737.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	35	728	5.9e-101	0.6462765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.37e-104	38	879	6	794	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	5.07e-19	722	806	5	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	3.07e-18	29	488	26	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	4.06e-08	248	355	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	8.51e-06	810	890	2	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDN32015.1	0.0	22	905	11	874
ADU13784.1	3.45e-221	10	861	9	857
AFD08955.1	2.41e-220	47	868	16	815
ANY69293.1	6.29e-219	74	879	19	842
QJB41769.1	9.62e-214	44	884	30	855

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	1.25e-198	46	867	10	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.32e-198	46	867	12	818	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.37e-198	46	867	12	818	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	3.61e-198	46	867	10	816	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.55e-196	46	867	10	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CGA8	5.69e-123	47	867	9	828	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q0CCA0	1.06e-122	45	867	7	826	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	1.63e-121	47	867	9	828	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
Q2TXB7	2.23e-121	47	867	9	827	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	6.09e-121	47	867	9	827	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000027	0.007136	0.992833	0.000004	0.000006	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003926_00737.