CAZyme Information: MGYG000003926_01145

Basic Information

• Species: Rikenella microfusus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Rikenella; Rikenella microfusus
• CAZyme ID: MGYG000003926_01145
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	MGYG000003926_123|CGC1	43735.56	8.2365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003926	2402156	MAG	China	Asia

• Gene Location: Start: 4425; End: 5618 Strand: -

Full Sequence      

MKHLLSLFFLGFLCHFPASAQRPYTVVRQPGQDGVHTCRIPGLATTPKGTLLAIYDARYE
SSRDLQGRMAIGLSRSTDRGKTWEPMRTVLDMGRWGGLPAKYNGVSDACILVDSASGKIY
VAGLWMHGLLDDEGKWIEGLTEDSTRWQHQWVGRGSQPGTSPYRTCQFLLAESSDDGRTW
SAPRNITASVKRPEWWLFAPAPGRGIVTRDGILVFPTQGRDSAGIPFSGIMYSTDRGRTW
HASAPAASQTTECAVAELGDGRLMLNMRNNRRTGRVVCTTADLGESWQVHPTSEKTLVEP
VCMASLHRHVYTEKGTAGSVLLFCNPASATERRNMTLRVSRDDGTSWSRGILLDSTLSFG
YSCITTLDQHTIGVLYESGGSRIVFQTIGLDELLRAE

Enzyme Prediction     

No EC number prediction in MGYG000003926_01145.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	25	381	2e-95	0.9415204678362573

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	3.69e-94	25	388	1	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13859	BNR_3	1.21e-21	40	287	1	211	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	2.14e-21	49	362	1	266	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	1.16e-10	39	382	276	705	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
PTZ00334	PTZ00334	1.37e-04	203	287	263	346	trans-sialidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM54135.1	3.70e-164	17	397	134	523
QUT80879.1	7.65e-161	27	395	170	546
QDM12165.1	7.65e-161	27	395	170	546
CBK69352.1	8.39e-160	27	395	158	534
QUR42287.1	1.24e-159	27	395	170	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MYV_A	2.11e-105	27	395	170	522	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	4.55e-105	27	395	191	543	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
6MNJ_A	1.61e-104	27	395	189	539	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
4Q6K_A	4.07e-102	20	395	166	525	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]
4FJ6_A	2.16e-101	27	394	170	521	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	4.86e-105	27	395	192	544	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
Q02834	1.07e-35	31	379	60	388	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P29767	9.81e-29	16	393	372	826	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
A5PF10	2.96e-26	35	382	75	400	Sialidase-1 OS=Sus scrofa OX=9823 GN=NEU1 PE=3 SV=1
A6BMK7	7.51e-26	35	379	74	396	Sialidase-1 OS=Bos taurus OX=9913 GN=NEU1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000275	0.998969	0.000291	0.000162	0.000148	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003926_01145.