CAZyme Information: MGYG000003926_01624

Basic Information

• Species: Rikenella microfusus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Rikenella; Rikenella microfusus
• CAZyme ID: MGYG000003926_01624
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
723	MGYG000003926_235|CGC1	80443.54	5.1495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003926	2402156	MAG	China	Asia

• Gene Location: Start: 406; End: 2577 Strand: -

Full Sequence      

MRNLILPGLAALLAAACSSGPRPAEIAVIPQPARIVESEGFVKIGPDNVRTAVDTAMSNP
EGYRLRVGDGGAEIVGGSDAGVFYGLQTLEQLRDSAGRAPQVTIEDAPRFRWRGMHLDVS
RHFFPKEFVKRYLDILAYHKINTFHWHLTDGIGWRLQIDKYPLLTQKAAWRKVKDAKSPW
IGLELSDESRHDSADTYGGYYTKDDVREIVAYARERHITVIPEIEMPGHSEAATFAYPEY
ACPTARPGSGIYCPGREETFGFLEGIIDEVVELFPDSPYIHIGGDEVGKEQWSACPLCQK
RKREQGLKDEHELQSYFVHRMEEYINSKGKAMIGFDEILEGGLAPNATVMSWTGFEGGIK
AANAGHDVVMVPLDYVYFDHYQGQNPCEPQAWGGYNNVKRVYSFDPVPPGIAPENEHYVL
GGQANIWTETIRTPEHVEYMLLPRLAALSETLWSDTTVKDWKRFERKLDRQLDRYAAKGW
KYAESAFTPYIAEQRFNGDGSLTVKLDTELDGYPVYYTLDGSVPTQESAVYTDSIMIREP
ATLTAVTFRNGKPTGCTLTVPGLLNKATRAKVSYATSYNAAYTGGGDTALVDNRYAFKRG
DDKAWQGFEGKDMDATLDLDSVQSLSGLGLRFYQHIASTSVMLPTRLTVWTSTDGKDFTV
AADRAIEPNDDSEALIAPFDVRFTAPVEARYVRVKAANAGVLPEGHPRAGAPAWIFTDEI
VVY

Enzyme Prediction     

No EC number prediction in MGYG000003926_01624.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	105	455	4.2e-124	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	110	468	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.85e-169	110	454	1	344	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	2.95e-136	61	555	206	709	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06570	GH20_chitobiase-like_1	1.29e-91	110	468	1	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06568	GH20_SpHex_like	2.19e-86	110	468	1	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCX39653.1	1.60e-220	49	720	88	758
ARS36380.1	3.52e-190	61	722	111	776
BBE18475.1	2.85e-187	45	722	90	780
ATL49555.1	2.95e-187	41	722	70	748
QNA46249.1	5.20e-187	52	722	90	766

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	3.46e-160	45	722	90	773	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7CBN_A	2.51e-113	31	482	46	510	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
3RCN_A	7.00e-102	49	482	67	513	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
7DUP_A	5.94e-90	61	484	79	522	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	3.20e-89	61	484	79	522	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	4.04e-126	53	532	102	582	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	1.90e-112	31	482	65	529	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	6.38e-77	46	449	189	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	2.99e-71	6	468	5	462	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q04786	8.57e-60	46	453	251	717	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003926_01624.