CAZyme Information: MGYG000003927_00462

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E
• CAZyme ID: MGYG000003927_00462
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	MGYG000003927_4|CGC1	37295.29	5.1281

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003927	2497009	MAG	China	Asia

• Gene Location: Start: 50005; End: 50973 Strand: +

Full Sequence      

MSDKLYIPSNPNAQQGVRNVLKYLSDITYEKIITGQHTQTMAQEELHLIEKVTGKQPALL
GFELLSYSPNINYTDTDEECMTEVTENYGTLKRVWEWAEKKGLITMCWHWFSPLYGRSKS
FFSENTDFDASKAVIDGTPENKALLSDMDTMAGILRPFCEKGVPILWRPFHEGDGDWFWW
GKKGADTVKKLFRLMHDRYTNKFHLDNLIWVWNSQVPECYPGDDVVDIISRDMYPPEHEH
TSQSEMYYNLCEITSAKKITIIGETGTLPSPEAVVSEKVGWSSYMTWSKPFCLTEKFNTH
EQLKKVYNSEFAVTKDKLPDLY

Enzyme Prediction     

No EC number prediction in MGYG000003927_00462.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	9	316	3.8e-96	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.48e-46	10	316	2	310	Glycosyl hydrolase family 26.
COG4124	ManB2	5.10e-14	162	234	179	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK96616.1	2.01e-245	1	322	1	322
CBL34621.1	1.12e-242	1	322	1	322
QTE69139.1	6.21e-157	8	322	7	321
ADU22555.1	2.48e-154	8	322	8	322
AZK45707.1	2.32e-140	8	322	6	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.36e-63	8	318	6	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	4.81e-59	8	319	34	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	1.59e-58	9	318	146	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	6.13e-42	13	287	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	7.76e-42	8	318	23	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.07e-61	9	318	175	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	1.46e-57	8	318	28	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	3.70e-54	9	320	147	459	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	1.07e-51	12	313	32	328	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	8.21e-47	10	319	159	461	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003927_00462.