CAZyme Information: MGYG000003927_01051

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E
• CAZyme ID: MGYG000003927_01051
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441		49499.92	4.4205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003927	2497009	MAG	China	Asia

• Gene Location: Start: 38158; End: 39483 Strand: +

Full Sequence      

MKARALKSIIAAVLAVSMLAGCAGNTTSDNSSLVSSGTVSSAEATSDESISQDSSTENKN
DSSQESTEQSGNDTSEPAVDSEPGVMRDITSQQLVDDMTFGWNLGDTLDVCQADRDGDGK
VNEHVEKGEKVDETLWGNPKATKELFTQLKSDGINAVRIPVTWRDHMDADGNIDKDWMDR
VQQVVDYAYSQEMYVIINVHHDGGGDPKFGAWIIEESQKDYDAFLKKYKNVWEQIAERFK
NYSDYLIFESMNEVGFDTLYNKNKADAYDLINRINQDFVDIIRATGGNNAKRHLLIAGYY
TDIERTCDSLYKMPDDPENRCIVSVHYYTPWDFCTCDIKHTWGTKAEVRQMETLIGKMKT
NFVDKGIPVIIGEYAASGSDLSSCIFFIEKLNKLCSDYGIATFIWDNGGQINRNTYQWRT
PKYLAAIQRATSGEDYEVVKS

Enzyme Prediction     

No EC number prediction in MGYG000003927_01051.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	133	408	1.8e-101	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.41e-55	133	409	16	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	8.95e-28	76	418	28	370	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
PRK08581	PRK08581	0.001	2	76	3	77	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL35063.1	1.28e-250	84	440	138	494
CBK96026.1	3.84e-248	1	440	1	449
CCO05659.1	4.51e-163	81	438	42	394
CBL17363.1	7.80e-94	84	428	29	371
ADL52801.1	4.30e-88	74	428	33	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XRK_A	1.59e-66	90	422	23	362	GH5-4broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate],6XRK_B GH5-4 broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate]
6WQP_A	9.94e-66	83	429	8	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6XSU_A	5.79e-65	89	420	11	340	GH5-4broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens],6XSU_B GH5-4 broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens]
6GL2_A	9.43e-65	84	427	7	335	Structureof ZgEngAGH5_4 wild type at 1.2 Angstrom resolution [Zobellia galactanivorans]
4X0V_A	9.37e-64	93	429	42	393	Structureof a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_B Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_C Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_D Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_E Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_F Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_G Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_H Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P28621	5.22e-59	86	429	37	372	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P23660	1.73e-57	84	427	20	359	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
Q12647	8.79e-57	86	427	20	359	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
O08342	1.68e-56	86	408	35	369	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P10477	6.32e-56	86	434	52	388	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000031	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003927_01051.