CAZyme Information: MGYG000003929_01318

Basic Information

• Species: CAG-590 sp900544905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp900544905
• CAZyme ID: MGYG000003929_01318
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		36118.62	4.5724

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003929	3094552	MAG	United Kingdom	Europe

• Gene Location: Start: 146844; End: 147782 Strand: -

Full Sequence      

MAMPVNPGATKNAVQLLDYLYETAGNGIITGQHTQTVPMEEIEYIRKVTGKEPKLRGFEL
LACSPNINYEDTSEPCMQEVYENRGTLETAYQWAKETEGIVTFTFHWFSPIGGRDKSFYA
EHTDFDASRVLEEGSPERTAFFHDMDVIAESLKCFCEADIPILWRPFHESEGTWFWWGAK
GAEIARELYKLMFVHYTQVHHLDNLLWVWNCPLKEGYPGDEYVDVVSVDIYLEKYESTDY
REHYEKLVAATTGNKVAALAEVGYIPDIHKLEQSRVPWAYYMTWSKEFCIGEQYNRTEQL
KSMYASSYSVTL

Enzyme Prediction     

No EC number prediction in MGYG000003929_01318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	312	1.9e-92	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.02e-47	5	311	1	308	Glycosyl hydrolase family 26.
COG4124	ManB2	1.68e-13	160	264	180	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM01251.1	5.49e-163	9	312	13	334
CBK82137.1	1.29e-156	1	311	1	311
AEB13973.1	9.82e-144	1	312	1	310
QUL56288.1	3.57e-128	2	312	7	317
AZK45707.1	6.47e-128	4	312	6	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	2.46e-61	4	311	6	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	8.88e-58	6	312	147	444	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	4.11e-45	4	312	34	349	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	1.57e-35	4	311	23	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	1.19e-33	8	284	49	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5AWB7	3.00e-57	4	312	28	347	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
G2Q4H7	1.33e-53	6	312	176	473	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	4.43e-47	9	288	151	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	3.90e-44	5	312	29	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	4.81e-41	5	304	157	448	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003929_01318.