CAZyme Information: MGYG000003929_01781

Basic Information

• Species: CAG-590 sp900544905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp900544905
• CAZyme ID: MGYG000003929_01781
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000003929_5|CGC2	55414.28	4.7437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003929	3094552	MAG	United Kingdom	Europe

• Gene Location: Start: 53067; End: 54509 Strand: +

Full Sequence      

MNTFRKDFLWGGATAANQYEGAWDVDGKGPSVSDMCTNGSHTTPKRVTREFEEGTLYPSR
EATDFYHHYAEDIALAAEMGFKCFRMSIAWTRIFPTGMEKEPNEAGLAFYDKVFDECRKY
GIEPLVTISHYEMPYALVEKCNGWEGRECIEYYMNYCKAIFERYKDKVTYWLTFNEINSG
TMPMGNVLSLGTIKGYSGSIMEVPDNPQVRFQALHHQFVASAMAVKYAHDNYPQFKMGNM
CIFATMYPYTCNPDDVIETQKQMQMMNWFTSDIHVRGYYPSYSERFFEENNIVIKKEDGD
DEILKNGTVDFYTFSYYMTNCVSTDPEVAANSSGNLMGGVKNPYLKASDWGWQIDPKGLR
YTLNELYGRYQIPLMVVENGLGAYDKLEEDGSIHDSYRIDYLREHIREMKEAVKDGVDLM
GYTPWGWIDVVSASTGEMAKRYGFVYVDKYDDGTGDLGRRRKDSFYWYKKVIESNGENLD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	476	4.1e-146	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	479	1	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	480	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	3	479	5	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	480	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	3	480	5	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF44001.1	1.64e-303	1	479	1	478
QRT31043.1	1.37e-286	1	480	1	479
QJA03662.1	3.06e-283	3	479	4	479
BCN32466.1	1.14e-280	1	479	1	478
QFJ54814.1	2.68e-279	1	479	1	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	3.22e-199	3	479	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	4.37e-192	4	479	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	7.61e-176	1	479	4	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.17e-175	1	479	4	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	2.24e-170	4	480	11	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	1.76e-198	3	479	7	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.37e-190	1	479	1	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	2.80e-185	4	479	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	3.25e-180	3	480	6	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	1.47e-176	1	480	1	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003929_01781.