CAZyme Information: MGYG000003930_00035

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-306
• CAZyme ID: MGYG000003930_00035
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000003930_1|CGC1	43292.81	9.5118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003930	1618032	MAG	United Kingdom	Europe

• Gene Location: Start: 34583; End: 35722 Strand: -

Full Sequence      

MGKKLFIITGELSGDKHASLVVEHLREIKPDIEIEAIGGENLKNLGVKLFVDHSQAHMSA
MGLTPKILLDHITLGKRVVDYIKNQYKPDLVLLIDYGGFNLNISKFLKKAGIKVFYYIPP
QIWASRKWRIKTVKKNIAKVMTIFPFEKEMYEKEGIDAQFVGHPLITQMPPQANRDEIFE
KYGLDKNKKLISIFPGSREFELYNLMDTFLKSAELIKEKRNDVQFVIAQADSLSDKLFKK
YLKQSDIKVVKHDNYSLLSVSDALMLASGTVALEAALYTTPMIISYKGPWIAYLIYRLVR
CINRVCLPNIIMDKDIVPELLMSDSNPKVISKNLLKILDDEQYRNNMIDDLSKVKSLLSK
HEASKEVAQIIAAELQQQN

Enzyme Prediction     

No EC number prediction in MGYG000003930_00035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	6	358	1.6e-105	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.86e-119	3	378	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.39e-100	3	377	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.79e-72	5	371	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.81e-64	7	376	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.41e-44	3	372	2	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.40e-159	3	375	2	372
AGB42297.1	3.41e-80	7	371	2	367
QMU61387.1	1.66e-77	5	372	13	381
BCG65050.1	1.97e-77	3	371	6	375
AKQ33376.1	1.47e-76	3	370	6	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	8.80e-43	7	349	11	356	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.39e-42	7	349	11	356	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	2.61e-73	3	368	4	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B6J161	3.02e-73	3	371	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	4.26e-73	3	371	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J9H1	6.01e-73	3	371	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9NCA7	6.01e-73	3	371	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003930_00035.