CAZyme Information: MGYG000003930_01004

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-306
• CAZyme ID: MGYG000003930_01004
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
226		24282.79	10.1438

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003930	1618032	MAG	United Kingdom	Europe

• Gene Location: Start: 24996; End: 25676 Strand: -

Full Sequence      

MFSPTIQAYIDQGGKDAAMQRVQSIRAHVANIEKQLNPESVKAEQKTFAEILKASQNGEG
QFRTGSKNFLSLTSAANALEKNTVKAAKNVETKITNVVNPTKQQIVDLISKISQKYGVDE
KLVMAVVRQESGFNPKATSHCGAMGLMQLMPATAKGLGVKDAYNPVQNVDGGVRHLKGLL
ARYNGNVVLALAAYNAGGGNVDKYGGVPPFKETQNYVKNILANYLG

Enzyme Prediction     

No EC number prediction in MGYG000003930_01004.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	121	224	4.9e-34	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	2.17e-54	107	224	8	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.29e-54	120	224	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	3.48e-45	107	224	6	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.07e-38	109	216	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.32e-34	68	224	104	280	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38062.1	2.71e-60	1	225	1	238
QNF30947.1	3.49e-53	107	224	30	147
QHZ46261.1	3.30e-52	48	224	32	208
QHC03268.1	2.35e-51	22	224	12	204
ATH95075.1	2.61e-51	103	224	98	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.19e-14	53	223	358	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.19e-14	53	223	362	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.20e-14	53	223	368	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.21e-14	53	223	372	565	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.22e-14	53	223	378	571	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.59e-49	66	224	23	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.67e-41	109	224	1426	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.67e-41	109	224	1426	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	3.07e-20	107	223	9	118	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P44888	1.74e-15	114	222	437	567	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999375	0.000672	0.000017	0.000001	0.000001	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003930_01004.