CAZyme Information: MGYG000003931_00792

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1880
• CAZyme ID: MGYG000003931_00792
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794	MGYG000003931_6|CGC1	86858.2	7.6622

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003931	1842922	MAG	United Kingdom	Europe

• Gene Location: Start: 74657; End: 77041 Strand: -

Full Sequence      

MKKINFCDGWTVKSGGEEVSVTLPHDAMFSEARDGGNPSGKNGAYFAGGNYVYTKKFIPD
EKWRGNSVYFVAESVYRNGKVLLNGKELAGRPYGYLPITADLTDELEYGKENELKVTAEN
SDQPNSRWYTGAGMYRPASIYVLPARHMLLHGVGIKTTDYKTRAFVIDVSANADGEVSAK
IVYDGKTLWSGKTELSGGKGRLEGIATGAPLWSAESPSLCTLEIEFGEDRRQISFGFRQL
FWSAKTGLLVNGERVILRGACIHHDNGPIGAAGHPFAEERKVRLMKEAGYNALRMAHNPC
SEAIMAACDKLGMYILDEYVDMWYIHKDKYDYASYHADWWERDLADIVEKDRNSPSVIMY
SIGNEVAETSEERGIKLTEDMTEYIHGLDDTRPVTCGVNIFFNLLYSMGMGQYSDKKAEK
NAKKQAAAAGKKKKKAVGSEFFNNLAGLLGARFMKFGATLRGSDKRTRDAFAKMDVAGYN
YGIGRYKKDFVKYPDRIILGSETFCADAAEFMRAAEAHPALIGDFVWAGMDYMGEVGVGS
WVYGDRTDDFSGGVGWLTAGSGRVDINGGMLGEAAYTRVAFGLDDVRVAVVPPVHAGRKH
SPSAWKFSDARESWSYDGCEGVKTKAEVYARAARAEVYVNGKKAGAGRIKKNGRAVIRVK
YLGGELTAVAYDESGKETGRSTLRSAGKETVLTARPEQAVIPSDGLAYIRLEYTDGAGTL
KPLVRSRIKVTEVTGGELIALGHACPFNPDGFGGRETDTYFGEALAVVRPNGSGYIKLEA
ESAYGKAEATVKIV

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	8	545	5.2e-84	0.5824468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.70e-46	28	395	38	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	3.30e-24	46	402	63	452	beta-D-glucuronidase; Provisional
PRK10340	ebgA	8.05e-22	37	394	108	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	3.26e-18	248	396	8	160	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam18565	Glyco_hydro2_C5	3.27e-14	692	792	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAM48408.1	1.26e-311	3	794	2	786
QRT30385.1	2.23e-294	1	793	1	794
QHB24152.1	2.23e-294	1	793	1	794
QEI31653.1	2.23e-294	1	793	1	794
VEU79851.1	3.72e-286	1	793	1	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	8.54e-105	1	769	5	751	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	1.79e-104	1	769	5	751	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	1.16e-71	8	782	52	808	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	7.07e-71	1	793	1	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	9.04e-64	21	790	42	803	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.32e-69	21	793	74	846	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	9.86e-51	21	397	78	457	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	3.58e-24	20	390	81	455	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q56307	7.42e-23	3	420	73	501	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q03WL0	1.70e-17	52	394	117	479	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003931_00792.