CAZyme Information: MGYG000003931_01135

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1880
• CAZyme ID: MGYG000003931_01135
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291		32455.89	4.1792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003931	1842922	MAG	United Kingdom	Europe

• Gene Location: Start: 3583; End: 4458 Strand: -

Full Sequence      

MKTHGKIFRIVAAIALLISAAVLVALPACGGTDFNCTFGQTQGGNDNGTPGGVTKPEEDL
SDVPEKPETEINKIIDFSTSGNLPVNGWETANWENDPGLFGCKWSYNNVWVDEDGKLRLE
IRDPKTSGDTANYNEYRTGGEIRTTAKYGYGYYSVSMKPMKADGVISSFFTYTGDPRWDE
IDIEFLGDDTTKVQFNYYTNGKGGHEFVYHLGYDASEDFHTYGFEWLEDCIIWYVDGKPV
HKATVEIPAYEQQIMMNLWNIAETGPDDWAGVYKGDLGTAYYEWVGFDAAA

Enzyme Prediction     

No EC number prediction in MGYG000003931_01135.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	86	285	2.5e-65	0.9514563106796117

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02175	GH16_lichenase	5.00e-82	82	289	7	212	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
pfam00722	Glyco_hydro_16	5.40e-45	104	286	1	168	Glycosyl hydrolases family 16.
cd00413	Glyco_hydrolase_16	6.01e-44	76	285	2	207	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	7.03e-39	90	289	56	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd02176	GH16_XET	1.76e-25	137	276	35	185	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD61790.1	2.50e-69	45	290	26	256
CCO06214.1	1.33e-68	52	289	21	253
AIQ43119.1	2.45e-65	88	287	44	237
QCT01047.1	3.03e-65	88	285	62	253
AIQ31818.1	9.83e-65	88	287	44	237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1MAC_A	1.19e-65	88	285	16	207	CrystalStructure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
1BYH_A	1.27e-65	84	285	9	209	MOLECULARAND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]
1U0A_A	1.02e-64	84	285	9	209	ChainA, Beta-glucanase [Paenibacillus macerans],1U0A_B Chain B, Beta-glucanase [Paenibacillus macerans],1U0A_C Chain C, Beta-glucanase [Paenibacillus macerans],1U0A_D Chain D, Beta-glucanase [Paenibacillus macerans]
1GBG_A	9.33e-63	84	285	9	209	BacillusLicheniformis Beta-Glucanase [Bacillus licheniformis]
3O5S_A	1.97e-62	74	285	21	233	CrystalStructure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23904	1.44e-64	88	285	41	232	Beta-glucanase OS=Paenibacillus macerans OX=44252 PE=1 SV=2
P45797	8.41e-64	77	285	20	233	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1
O14412	1.48e-63	74	289	39	242	Beta-glucanase OS=Orpinomyces sp. (strain PC-2) OX=50059 GN=licA PE=1 SV=1
P07980	2.78e-62	71	285	19	234	Beta-glucanase OS=Bacillus amyloliquefaciens OX=1390 GN=bglA PE=3 SV=1
P04957	2.44e-61	84	285	37	237	Beta-glucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=bglS PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000028	0.009144	0.990821	0.000003	0.000006	0.000005

TMHMM  Annotations     

start	end
7	29