CAZyme Information: MGYG000003937_00357

Basic Information

• Species: Gemmiger qucibialis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger qucibialis
• CAZyme ID: MGYG000003937_00357
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628	MGYG000003937_10|CGC1	70127.07	6.9528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003937	2463546	MAG	United Kingdom	Europe

• Gene Location: Start: 26995; End: 28881 Strand: -

Full Sequence      

MAQDTNQNRPADVAQADSVGGMAKRLLNPAHLSDLARRSAATLKEQGAEQLWRDVTFRVG
LAFHHDSWQHRADLPLRRELKAQRAEYADGKPGPVVSVVVPLYNTPEKFFGQMLASVQKQ
TYPHWQLVLVDASDAAHAAFSTHASKAAAKDPRILYKKVENGGIAANTTAGFALATGTYI
ALLDHDDVLYPNALYESVKTLQGQGAELVYSDEIVLSADLKQLGGYHFKPDFAPDYLRGV
NFITHLAVFSRALLDRAGAYESSEYDGAQDHDLMLRLTEQTTRDKIAHIKKVLYIWRGHA
GSTAAGMEAKPYALAAGVRAIDAQLKRLNLPGKAMEVKDAPGAFQVRYELTGHPLVSVMI
PNKDHIDDLDRCLKSLYANAGYDNFEVLVIENNSEQQETFAYYKTMPERYPNSRVVTYVG
PFNFSAVNNLGARFAKGEHLLLLNNDIEVLSHDFLRELLSYSQRPDVGAVGAKLYYPDDT
IQHAGVIMGINGSAGHSHKSYPRKAVGDLYRLVTTQDYMAVTGACLMTKTELYRAAGGLD
EAKFAVAYNDVDYCLKLWQKGLLNVYTPRAEAYHYESKSRGLDTTPENAARYAREKANFY
TKYHEYIDHYDPYYNPHFNNLFENFGLK

Enzyme Prediction     

No EC number prediction in MGYG000003937_00357.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	97	209	3.2e-19	0.6529411764705882
GT2	356	597	1.4e-18	0.9608695652173913

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.98e-70	103	297	10	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	7.24e-40	358	576	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.22e-26	354	606	3	249	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	3.92e-17	103	303	7	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	9.20e-15	103	283	6	153	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22278.1	4.18e-164	96	608	98	609
AXA82332.1	1.04e-163	74	600	47	580
CBK99650.1	1.18e-162	74	600	47	580
QMW89744.1	1.77e-162	97	628	86	615
BBK78193.1	1.77e-162	97	628	86	615

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	7.72e-123	93	595	365	866	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.62e-88	94	587	319	805	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.11e-07	94	276	8	193	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
A0A0H2UR96	1.61e-07	95	209	4	116	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q9ZDI9	1.78e-06	94	231	8	139	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003937_00357.