CAZyme Information: MGYG000003937_01569

Basic Information

• Species: Gemmiger qucibialis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger qucibialis
• CAZyme ID: MGYG000003937_01569
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
952	MGYG000003937_99|CGC1	106193.16	5.0896

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003937	2463546	MAG	United Kingdom	Europe

• Gene Location: Start: 5715; End: 8573 Strand: -

Full Sequence      

MPQITIGKGLAFYEEAQALPGVKRVAGMVKQDIELVTGILPAGITAGQGSGCAVLYGTIG
HSPMLDALEAAGKLDLNAIRGKWECYSFQVIETPLVGIGAALVIAGNDKRGTIYGLFHLS
ELIGVSPLVNWNHVLPRHQDTVVLDDRVNMVSRVPSVKYRGFFINDEWPAFGNWAKTHFG
SMNAACYAPVFELLLRMKGNYLWPAMWNSNFSLDGPGLENAVLADELGVVMSTSHHEPCM
RSGQEYSMVRGRGSIYGDAWDYIANPEGITRFWRDGLTRNKDFENVITLGMRGENDTAIM
QHATLEENIQLIRNVLKTQNQLIREIINPDVRQVPRQIVFFSETEEFFYGSKETPGLIGD
PELDGVTLMLSDNNHGSTRTLPSPEMRSHPGGYGMYYHMDMHGGPHSFEWVGATYLPKVW
EEMTAAYEYGVREIWVTNIGDIGTQEFGLSYFLDLAYDIDVWGGQDAAITTQYTAQWVRR
NFGAAFAPADLPRIEGIITDYTRLLARRKHEKMGENTYHPTHYGEAEEVLQISEHILTEC
DALKTACPQENLSAFISLIYFPACGTANLMKMWILTGRNHLYAKQNRVAANRLADEVQAC
IEADEALVNEYHTVDGGKYYGFGLSEHIGFVYWNDEDNKLPIRMYITPANRPRMIVSRVE
DTEYATGFWWNGRKPQVWQDFLRPDVSQVAFDVACGSKCPISWHIETDCPWMQFSCTGGT
VAENQRVTLTIDRSQITGKAAGQFAVVNEHIQEGTGAANIIVEVDNTPVSYPKGTFVEAN
GCIAMEAQHYTAKRDVPGGGFALLKPYGRLGTALKVFPATANFENSEERPYLEYTFAAAK
DGDYHVQFHMSATTPVTFEPKQYIGYSVNGGAVSVVNTVHEENRPFFGSEQWYAEGFANV
KLTEAVILCHAGVNTLRFYAVSPAIILEKIVLWPDGTTLPESYLGPRESYRC

Enzyme Prediction     

No EC number prediction in MGYG000003937_01569.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	9	930	5.3e-199	0.9827833572453372

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	7.02e-162	155	511	3	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.41e-43	775	948	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.003	34	119	39	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ95221.1	0.0	1	950	1	944
ADL32929.1	0.0	3	950	38	983
AET60998.1	0.0	7	924	16	931
QAY66984.1	0.0	5	950	9	963
BAM48432.1	0.0	9	950	17	962

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NPS_A	0.0	9	950	19	964	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4ZMH_A	6.12e-149	21	951	34	935	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	3.81e-116	2	667	45	673	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	8.36e-111	54	667	69	658	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	3.13e-109	54	667	68	657	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003937_01569.