CAZyme Information: MGYG000003941_00576

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000003941_00576
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		43664.36	4.5889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003941	2202352	MAG	United Kingdom	Europe

• Gene Location: Start: 28505; End: 29662 Strand: +

Full Sequence      

MKQLLLLAAICASGCAPEAEPASGLPDFLHATYSVESLLSEAELSNPGYDAFDFIYLMAT
PAEWPMIDFDLPRDEIVALADAFDYTRAGGHMPLVPQMVRKAHEAGTKILLCFGGQKEFL
PFLKKPDRLLNLEAYMVRLVADNDFDGLDIDWEITLDKELHAGMMNRLRAGLDSLAEERN
RTYYLTTALSIDHVYDRPLADSLSRAVDWINVMSYDMCDGIWGSTPSHNTSMARLREKLA
HWAPFDRRQLCLGLANYGFYYKGLKPGEKADGPLSRYGSYITYREFLPRVETGGWTEEYD
PEAEVSYYFSPDREEFVTIENPVSMRRKIEWITANGFRGVFWWEFHHDYVAPTAEQPAGR
HYLIDVVTDFLNGAEAGISKNTGNQ

Enzyme Prediction     

No EC number prediction in MGYG000003941_00576.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	74	356	4.2e-43	0.8108108108108109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	3.18e-39	101	348	61	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	1.63e-35	100	348	57	307	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	7.76e-32	101	348	79	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
COG3325	ChiA	4.99e-30	101	349	121	424	Chitinase, GH18 family [Carbohydrate transport and metabolism].
cd02872	GH18_chitolectin_chitotriosidase	2.72e-20	137	343	105	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL07649.1	3.34e-209	2	378	3	376
BBL10471.1	1.04e-191	2	371	3	371
BBL13265.1	1.04e-191	2	371	3	371
BBL02594.1	4.00e-189	2	371	3	371
BCI61687.1	6.89e-98	30	367	25	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KXN_A	7.73e-17	99	371	66	370	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KST_A	7.73e-17	99	371	66	370	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	3.45e-16	99	371	66	370	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6G9C_A	1.41e-15	46	373	46	400	Crystalstructure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9C_B Crystal structure of immunomodulatory active chitinase from Trichuris suis, TsES1 [Trichuris suis],6G9E_A Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_B Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_C Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_D Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_E Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis],6G9E_F Crystal structure of immunomodulatory active chitinase from Trichuris suis - TsES1 - 6 molecules in ASU [Trichuris suis]
6IGY_A	6.14e-15	70	376	36	381	Crystalstructure of Aspergillus niger chitinase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O10363	6.45e-15	98	348	246	532	Probable endochitinase OS=Orgyia pseudotsugata multicapsid polyhedrosis virus OX=262177 GN=ORF124 PE=3 SV=1
O14456	3.75e-12	98	376	115	403	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1
Q92222	6.12e-12	98	373	81	370	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3
G5EAZ3	6.12e-12	98	373	81	370	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
P32470	3.79e-11	101	380	116	420	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000056	1.000005	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003941_00576.