CAZyme Information: MGYG000003941_01314

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000003941_01314
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000003941_47|CGC1	41917.95	4.4472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003941	2202352	MAG	United Kingdom	Europe

• Gene Location: Start: 8838; End: 9965 Strand: +

Full Sequence      

MKKIIKTGLIALLVIPAFVRCSDWTEAEALDYDPNKTESNHGEAYYANLRDYKLRKDHPV
AFAWYSDWTGVGTDMSSQLMGMPDSMDFVSMWGNWYGLSDEKKEDLRKVQQIKGTRVLMC
FIVDDIGAQTTPPAISESLTVNGVQYETRGEALGAFWGWYQEGYSGTVYKSDPNLSDEEA
MDKAIRKYAQSLLDTINKYNWDGFDLDLEPHYGHGGNLASYPDRLSILLNELSKELGPQS
GTSKMLCVDGEPEWLNGEDGKLLDYFILQAYNDSSVSSIDSRINSLLATYQEHMTPEQIV
GMTILTSNFESYGSTGGPTFRQRDGSTTNQLSGYAAYSYPGVDARIGGIGAFRIVFDTNY
QYLRKAIGIMNPAIL

Enzyme Prediction     

No EC number prediction in MGYG000003941_01314.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16141	DUF4849	7.56e-64	25	369	1	318	Putative glycoside hydrolase Family 18, chitinase_18. This DUF is likely to be a form of glycosyl hydrolase from CAZy family 18, possibly chitinase 18. This would have the EC number of EC:3.2.1.14.
cd06542	GH18_EndoS-like	1.60e-39	59	363	1	247	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
cd02874	GH18_CFLE_spore_hydrolase	5.02e-07	175	361	82	258	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
pfam00704	Glyco_hydro_18	0.002	174	272	78	176	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA48309.1	6.65e-113	18	373	17	365
QUT69469.1	3.79e-112	18	373	17	365
QQA08131.1	3.79e-112	18	373	17	365
QMW86123.1	3.79e-112	18	373	17	365
QUT41628.1	3.79e-112	18	373	17	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q64_A	1.89e-55	17	367	15	352	BT1044SeMetE190Q [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.180997	0.818520	0.000072	0.000077	0.000069

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003941_01314.