CAZyme Information: MGYG000003942_00371

Basic Information

• Species: CAG-269 sp001916055
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp001916055
• CAZyme ID: MGYG000003942_00371
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
186		21430.99	9.7844

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003942	1586096	MAG	United Kingdom	Europe

• Gene Location: Start: 37657; End: 38217 Strand: +

Full Sequence      

MSRKVRRRFRKLIILIIIVLALVLSATPIKTKLTRRIYRKEYTEYVVKYSEQYGVEENLI
YALIKAESNFNPNAVSHQNAKGLMQLMDSTAEDLAKKCKINLKDKDILDPDVNIQLGTQY
LASLLNKYECVEVALAAYNAGSGNVDKWIKDGIIKADGSDIENIPYKETNTYVRKIMRDY
KIYKQL

Enzyme Prediction     

No EC number prediction in MGYG000003942_00371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	57	182	2.1e-32	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	6.82e-68	40	182	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.98e-59	42	186	6	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	5.48e-42	57	181	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	1.42e-34	44	181	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
COG0741	MltE	4.08e-34	38	186	135	286	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU68364.1	3.13e-43	51	186	50	187
AIS52076.1	6.23e-39	52	186	45	181
AEY66639.1	1.61e-38	51	186	53	190
ACL76418.1	3.65e-37	52	186	54	190
CED93144.1	5.20e-37	51	186	45	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	2.48e-19	54	185	461	594	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	2.51e-19	54	185	490	623	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	6.25e-19	54	185	461	594	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	6.25e-19	54	185	462	595	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	3.89e-16	51	186	425	558	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.18e-23	51	180	69	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	4.72e-17	52	180	1432	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.72e-17	52	180	1432	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P44888	2.49e-14	51	186	437	574	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
C5BCE9	6.07e-14	51	186	200	358	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.671145	0.318255	0.007004	0.000313	0.000275	0.003012

TMHMM  Annotations     

start	end
12	29