CAZyme Information: MGYG000003942_00754

Basic Information

• Species: CAG-269 sp001916055
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp001916055
• CAZyme ID: MGYG000003942_00754
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855		99387.74	7.0571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003942	1586096	MAG	United Kingdom	Europe

• Gene Location: Start: 8836; End: 11403 Strand: +

Full Sequence      

MYVFNRITVNPQLPKRIGRITEIANNLWWSWNTEFLRLFKMIDIDLWERCNKNPVKFLKS
VEQEKLENAARDIAFIKEYDKVVSNFDSYMNSKSTWFNSKYPDNRNDLIAYFSAEYGLDQ
TIAIYSGGLGILSGDHLKSASDLGIPLVAVGLLYKNGYFNQIIDRYGMQRPEYRDLDIYD
LPITPVKDLDGNDLILFIKFPKRRIYLKVWEINVGRIKLYLMDSDIDINNVEDRDTTARL
YGGDQEMRIRQEIILGMGGVSLLRRLGLTPTVYHMNEGHSAFLNLELIKNTIKEKQVSFD
VARDIASSKTVFTTHTPVPAGNDIFPLDLVEKYFKDFWPRLGLTREEFLKLGMKPCEGLE
PGFNMGIFALKIAGKKNGVSKLHGEVSRELFADVWPHIAPSESPITYVTNGIHTCTWLAP
KMKELYNKYLMPYWQDNIHEDYVWEKIRTIPDEKMWKVHMERKEKLIALVKENVTRRLRR
EGVSYEEITEATSKLNPEALTIGFGRRFATYKRATLIFKDLERITQILNDENRPVQLIFA
GKAHPADREGADLIKYIHEISMKPQFKGKIFILENYNIEISRYMVSGVDVWLNNPRRPME
ASGTSGQKASVNGVVNFSVLDGWWAEGYNQKNGWAIGTNKEYSSYEEQDIADSNSIYYTL
ENKIIPTYYDKDRNGISKSWMEYMKNSIMTTAGKYSTARMLVDYTRKLYIPLCNLTKKYY
TDLNRVTEYDAWKASMYSNWKDVKIEQIESNADNITVDAGEEIEVRCEVTLPNIDSNSIR
AEVYYGKFLENGTVQDIKIIPMKMEKRDEENRKYYYVAKINLTTGGNYGYSFRVMPQNEM
LLDSENMDLVKWIEK

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	271	705	2.4e-122	0.6186943620178041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0058	GlgP	0.0	22	755	8	748	Glucan phosphorylase [Carbohydrate transport and metabolism].
TIGR02094	more_P_ylases	0.0	109	711	1	601	alpha-glucan phosphorylases. This family consists of known phosphorylases, and homologs believed to share the function of using inorganic phosphate to cleave an alpha 1,4 linkage between the terminal glucose residue and the rest of the polymer (maltodextrin, glycogen, etc.). The name of the glucose storage polymer substrate, and therefore the name of this enzyme, depends on the chain lengths and branching patterns. A number of the members of this family have been shown to operate on small maltodextrins, as may be obtained by utilization of exogenous sources. This family represents a distinct clade from the related family modeled by TIGR02093/pfam00343.
cd04299	GT35_Glycogen_Phosphorylase-like	0.0	22	786	3	763	proteins similar to glycogen phosphorylase. This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences. Oligosaccharide phosphorylase catalyzes the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism.
pfam11897	DUF3417	5.58e-50	13	122	1	109	Protein of unknown function (DUF3417). This family of proteins are functionally uncharacterized. This protein is found in bacteria and archaea. Proteins in this family are typically between 145 to 860 amino acids in length. This protein is found associated with pfam00343. This protein has a conserved AYF sequence motif.
PRK14986	PRK14986	1.95e-14	126	622	123	676	glycogen phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUG58376.1	4.18e-313	1	852	1	852
ABN51595.1	9.63e-312	1	853	1	853
QNU65923.1	5.14e-311	1	854	1	853
ANV76629.1	5.51e-311	1	853	1	853
ADU74919.1	5.51e-311	1	853	1	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CEH_A	1.97e-14	118	622	103	672	Humanliver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
2QLL_A	2.03e-14	118	622	126	695	Humanliver glycogen phosphorylase- GL complex [Homo sapiens]
1XOI_A	2.03e-14	118	622	125	694	HumanLiver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]
2ZB2_A	2.03e-14	118	622	128	697	Humanliver glycogen phosphorylase a complexed with glcose and 5-chloro-N-[4-(1,2-dihydroxyethyl)phenyl]-1H-indole-2-carboxamide [Homo sapiens],2ZB2_B Human liver glycogen phosphorylase a complexed with glcose and 5-chloro-N-[4-(1,2-dihydroxyethyl)phenyl]-1H-indole-2-carboxamide [Homo sapiens]
3DD1_A	2.03e-14	118	622	127	696	Crystalstructure of glycogen phophorylase complexed with an anthranilimide based inhibitor GSK254 [Homo sapiens],3DD1_B Crystal structure of glycogen phophorylase complexed with an anthranilimide based inhibitor GSK254 [Homo sapiens],3DDS_A Crystal structure of glycogen phosphorylase complexed with an anthranilimide based inhibitor GSK261 [Homo sapiens],3DDS_B Crystal structure of glycogen phosphorylase complexed with an anthranilimide based inhibitor GSK261 [Homo sapiens],3DDW_A Crystal structure of glycogen phosphorylase complexed with an anthranilimide based inhibitor GSK055 [Homo sapiens],3DDW_B Crystal structure of glycogen phosphorylase complexed with an anthranilimide based inhibitor GSK055 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9YGA7	9.29e-225	9	852	8	825	Maltodextrin phosphorylase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) OX=523849 GN=malP PE=1 SV=1
Q7U078	1.52e-183	1	850	1	860	Glycogen phosphorylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=glgP PE=3 SV=1
P9WMW1	6.01e-183	1	850	1	860	Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgP PE=1 SV=1
P9WMW0	1.19e-182	1	850	1	860	Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glgP PE=3 SV=1
O66932	3.31e-178	22	709	12	684	Glycogen phosphorylase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003942_00754.