CAZyme Information: MGYG000003949_00207

Basic Information

• Species: Eubacterium_F sp900539115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_F; Eubacterium_F sp900539115
• CAZyme ID: MGYG000003949_00207
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000003949_2|CGC1	44847.46	4.6181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003949	2807569	MAG	United Kingdom	Europe

• Gene Location: Start: 1524; End: 2711 Strand: -

Full Sequence      

MRLRKWSIGVCAALGLALCLTGCGQSEQKETKNQPTTAAVTASAVTDSKSDAKTLKEAFD
GDFKVGVATTSGYLSEEDRVAQIKENFNSITMENEMKPESLLDWEGSEKSKDGMPAIKEE
TLEKALKAAREAGIPLRGHTLVWYSQTPEWFFSKKYDPSKGYVDKETMKKRMESYIKQVL
TYCKENYPGLVYAWDVVNEAVGDDGNYRTESMWYETYGDFSYIKDAFTFARKYAEEGTKL
FLNDYNEYIAQKRDLLYAKVVELHDAGLLDGVGMQSHWDMDFPSVDLFETALEKYASIDG
IEIQLTEIDMHNTDDSEEGLKKQAERYKEFFDVITKMKREGKANITSVTFWGLKDGESWL
SGFKGETSYPLLFTDDMEKKPCYESILEAGKTAQK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	55	389	1.4e-94	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	2.31e-104	55	388	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	4.14e-93	96	386	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	7.41e-75	65	388	36	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA43712.1	9.85e-89	55	390	3	338
ADL33823.1	1.98e-87	55	390	3	338
CUH92237.1	2.18e-83	55	387	263	600
BCS82260.1	1.46e-81	24	390	45	417
ADQ03735.1	1.95e-80	25	390	89	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OFJ_A	1.86e-69	55	390	11	339	Crystalstructure of N-terminal domain of bifunctional CbXyn10C [Caldicellulosiruptor bescii DSM 6725]
6D5C_A	3.59e-69	55	389	23	350	Structureof Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_B Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_C Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
5OFK_A	1.46e-68	55	390	11	339	Crystalstructure of CbXyn10C variant E140Q/E248Q complexed with xyloheptaose [Caldicellulosiruptor bescii DSM 6725],5OFL_A Crystal structure of CbXyn10C variant E140Q/E248Q complexed with cellohexaose [Caldicellulosiruptor bescii DSM 6725]
2W5F_A	2.96e-68	55	386	184	524	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2W5F_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
2WYS_A	2.53e-65	55	386	184	524	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WYS_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26223	1.97e-89	55	390	3	338	Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens OX=831 GN=xynB PE=3 SV=1
P23557	1.88e-74	96	390	1	302	Putative endo-1,4-beta-xylanase OS=Caldicellulosiruptor saccharolyticus OX=44001 PE=3 SV=1
P29126	5.69e-66	48	391	623	954	Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens OX=1265 GN=xynA PE=3 SV=1
P51584	2.34e-65	55	386	195	535	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P10474	3.31e-64	55	390	45	373	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000041	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003949_00207.