CAZyme Information: MGYG000003953_00861

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia
• CAZyme ID: MGYG000003953_00861
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
849		96382.63	6.0221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003953	1402329	MAG	United Kingdom	Europe

• Gene Location: Start: 115; End: 2664 Strand: +

Full Sequence      

MRCAADVLQRVRETIMMRLVNFKTEYQSCPLAVETKTPRFSWQYADGFTGTQASYRIFVA
SKPSLLQEGKADLWDSGTVRSSSCVGIAYAGAPLRSHSRYYVLCTARDAEGKEYGSEISS
FETALFDAADWKGGWVSVPNNFNGGTLLFRKLIRTDESKKIVRARAYVCGLGYHEFFVNG
KKIGQSVLNPGISEYSERVLYCVYPMDELRGGDNVVGVEVGYGWFGGRKLLVQIYIEYED
GTVLEDHSGPGNGWWVGGSPTVENSIYGGEVYDARIEDVYPRNWNTVGFCPTWANGWMYT
ISTPAPRGKLEAQQIEPIEVSARYPERSRTDKGGGVWIIDVGQNMAGWLRIRVQGERGAS
VTLKFGEQLTQEGYVNRINLRSARCTDTYILRGEGVEEYAPRFTYHGFRYVQAEISGKAE
LLSCVGEHVHTATRVVGDFSCSDEQLCRLHRIALVTERNNEHSVLTDCPQRDERFGWLND
LGSRIYQTVYNIDLARFIPKFIRDITHTQQPDGGIADTAPYYTGGVPADPVCVIYPLLAN
YAFRYYGDRRTAEEEYLGIRRWVEFLLSRSHGYIMDYSYYADWVPPFADVKTDELYVSTL
YLLWHLREMCRLAQITGHAEDEKRYAEHLQKCADAVHKKYFDREKCVYCGGTQSENALAL
SLGVVPQEFRARVAENIFRDAVARNHHCTGGNIGYRHIFYVLAEYGYTDEVVRILKNPEY
PGWGYMLEKDATTVWERWEAEMQNEMHSFDHPMFGSYDAFFYRFLGGISVDEDAFACDKI
GIEPVFTKLLDCVDCAMDTVRGKIVSRWKRGQGGIEIHVEVPPQTSARFRAGGISRTLSA
GSYDFLLQE

Enzyme Prediction     

No EC number prediction in MGYG000003953_00861.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	334	828	9.4e-136	0.9821428571428571
CBM67	143	289	2.4e-17	0.8181818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.49e-85	436	763	3	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.99e-45	159	320	1	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	7.37e-35	333	430	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.54e-07	767	828	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	2.88e-194	17	827	32	847
QEC51112.1	1.17e-186	17	843	69	910
VEH16339.1	1.31e-175	16	828	31	850
AHF90970.1	4.67e-174	25	828	14	841
AEF82974.1	2.72e-165	35	849	28	878

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	8.12e-145	21	822	34	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.74e-100	159	827	314	990	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.39e-90	25	827	10	842	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	7.66e-100	159	827	314	990	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	3.66e-99	27	827	40	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	3.85e-91	30	827	47	874	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.58e-78	30	829	43	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003953_00861.