CAZyme Information: MGYG000003956_00072

Basic Information

• Species: RUG131 sp900315885
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-826; RUG131; RUG131 sp900315885
• CAZyme ID: MGYG000003956_00072
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	MGYG000003956_1|CGC1	91251.63	4.9901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003956	1468191	MAG	United Kingdom	Europe

• Gene Location: Start: 85920; End: 88343 Strand: +

Full Sequence      

MKIIKKLLLTILFIVPCLTSCDKNESYKDENKRDLELHLTFDEGKGNVLHDKTKKHQDVT
LSYALSESETLKEKQNPIWRENGAIGGALLFDGYSQWASYNSNDISIKGKKLTISAWVAP
RAYSYDSQNAIDNDEEVLTGIVSQFYKDDKYAMGAILGYHRDGNFSFQVGTGNKLIEIWN
IDQRLKKYEWNYITATFDGVEGFMSLYLNGRIVNSKEIDKGSEIKSADVPLLIGTNNYAR
SSGSCFMDVVSGMLDDIKIYNTALKFKNIKEYFEANLINGKPREIAFSDIWLQDILKDDV
YKTQFHGGPYQHWMNEPHAPIFYKGIYHLFFQFNIMGPYFNNANGIAWGHLVSKDMVNWV
PLKEAIVPTLGSVAPDGVWSGGSTYSEVKGVKDVPTLLFTAGNLIHQNTLSNQNIGVATP
VDPSDPYLVEWEISSELAVTQIEGQGQIGEFRDAHVWIEGDTYYLAVGSRVKNTERGCVL
LYTSSRNNSDPMHNWKYRGILYDWVSQNPVRQYGSTWELPVMLPLTNINGEATNKYIFII
SPAPAETADNNIVYWIGTFDKENYRFIPDFDGAPKRMDYGRNVFTGPSGFIDPNTNMVTI
FSIMQDQRESSDLSASGWAHCVGLPRQLYLENNELRIRPISNIYNLEKNDTKIVINQNTN
VDSANEIIKNCSANLYNLKVKLSNFTSDAKVVIKVRKSENNEEFTSFSYNNEAKLIECSN
LTNGNNSLLSGGTSSGYFNASELEINIFVDNSLVEAFFNNTKTISVRSYPKDYYANGIEI
SIEKGNADIVFLEFVEFSMIDRSLSHE

Enzyme Prediction     

EC	2.4.1.-	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	306	637	1e-52	0.9897610921501706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08996	GH32_FFase	2.68e-80	312	630	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	2.31e-71	309	760	4	436	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	9.96e-50	309	633	4	300	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
COG1621	SacC	1.19e-46	301	785	28	473	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd18624	GH32_Fruct1-like	2.98e-38	312	630	1	296	glycoside hydrolase family 32 protein such as Arabidopsis thaliana cell-wall invertase 1 (AtBFruct1;Fruct1;AtcwINV1;At3g13790). This subfamily of glycosyl hydrolase family GH32 includes fructan beta-(2,1)-fructosidase and fructan 1-exohydrolase IIa (1-FEH IIa, EC 3.2.1.153), cell-wall invertase 1 (EC 3.2.1.26), sucrose:fructan 6-fructosyltransferase (6-Sst/6-Dft, EC 2.4.1.10), and levan fructosyltransferases (EC 2.4.1.-) among others. This enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD03331.1	2.11e-159	31	779	30	751
AAF24999.1	3.49e-143	35	780	9	737
AUS98640.1	7.40e-140	34	799	17	753
QHA93053.1	6.10e-136	32	780	7	718
AYA76414.1	3.10e-135	41	780	61	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QQU_A	1.59e-32	301	771	4	502	ChainA, Beta-fructofuranosidase [Arabidopsis thaliana]
2XQR_A	9.39e-32	301	771	4	502	Crystalstructure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_C Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_E Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_G Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_I Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana],2XQR_K Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor [Arabidopsis thaliana]
2AC1_A	9.79e-32	301	771	8	506	Crystalstructure of a cell-wall invertase from Arabidopsis thaliana [Arabidopsis thaliana]
2OXB_A	2.26e-31	301	771	4	502	ChainA, Beta-fructofuranosidase [Arabidopsis thaliana]
2QQW_A	2.26e-31	301	771	4	502	ChainA, Beta-fructofuranosidase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6DZC8	1.08e-34	300	650	59	393	Fructan 1-exohydrolase w3 OS=Triticum aestivum OX=4565 GN=1-FEHw3 PE=1 SV=1
B6DZD1	1.93e-34	300	650	58	392	Fructan 1-exohydrolase OS=Aegilops speltoides OX=4573 GN=1-FEH PE=3 SV=1
B6DZD2	4.67e-34	300	650	59	393	Fructan 1-exohydrolase OS=Aegilops tauschii OX=37682 GN=1-FEH PE=3 SV=1
Q70AT7	8.60e-34	300	650	62	396	Fructan 1-exohydrolase OS=Hordeum vulgare OX=4513 GN=1-FEH PE=2 SV=1
Q39692	3.46e-33	300	633	59	375	Beta-fructofuranosidase, insoluble isoenzyme 2 OS=Daucus carota OX=4039 GN=INV2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000005	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003956_00072.