CAZyme Information: MGYG000003956_00187

Basic Information

• Species: RUG131 sp900315885
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-826; RUG131; RUG131 sp900315885
• CAZyme ID: MGYG000003956_00187
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	MGYG000003956_1|CGC2	57355.77	9.1821

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003956	1468191	MAG	United Kingdom	Europe

• Gene Location: Start: 213779; End: 215251 Strand: -

Full Sequence      

MEKSAGLLLHISELPSKYGIGSFGIEAKRFVKLLKLAGQKYWQVLPLNPVGEGNSPYSSS
CSSALDPYFIDLDLLEKDGFLTKEEITNNSKKNTGRVDYEYLSSHRYNLLFLASKRLLQS
KTKTKVYNFYKRNKKWLKDYALFNILTDIYHTEWSSWPMNYRKHKNKDLEELIKNKQEEF
NCYVTMQYLAYSQYLKLKKYANKNGVRMVGDLPIYVSYNSSDVWAHQNDFMLAKCGKPLF
ISGMPADDMCKDGQVWGMPTYNYDYMRKNGFKWWKSRICQTSKLYDLLRLDHFIGFAEYY
AIPYATCLAKDGKWMKGPGTELIDIILNYSKADLFAEDLGYLSQNVIDLLNYSKIAGTKI
FEYGFNSDKNNPHIPNNYPYNAIAYLGNHDNDVFKNFIITHPNDEKNIRDYLNISIYDDI
IEESIENLFASKAKITILMVQDLLKMGKESRINVPGTLSKNNWSFRFKKSDFKKERFLEL
FELTCKYQRY

Enzyme Prediction     

No EC number prediction in MGYG000003956_00187.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	9	475	8.8e-137	0.9676113360323887

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	5.17e-170	1	489	3	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	2.53e-152	9	470	1	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	4.96e-122	1	490	26	526	disproportionating enzyme
COG1640	MalQ	2.46e-103	1	483	12	511	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	3.78e-96	2	471	13	495	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW44505.1	9.08e-122	1	489	1	490
AQW27958.1	1.34e-121	1	489	1	492
QUF79998.1	1.67e-121	3	489	2	491
SQI05652.1	1.89e-121	1	489	1	492
AXH53534.1	2.68e-121	1	489	1	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X1N_A	3.02e-104	3	470	26	501	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	1.30e-103	3	470	78	553	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
1TZ7_A	5.87e-99	5	479	24	495	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
6M6T_A	2.72e-97	2	489	4	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
5CPQ_A	1.02e-95	3	470	70	541	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	1.14e-112	9	489	1	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
Q06801	7.14e-103	3	470	78	553	4-alpha-glucanotransferase, chloroplastic/amyloplastic OS=Solanum tuberosum OX=4113 GN=DPEP PE=1 SV=1
O66937	3.59e-98	5	479	4	475	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
Q9LV91	7.67e-95	3	470	82	553	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1
P0A3Q0	8.64e-95	2	489	3	495	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003956_00187.