CAZyme Information: MGYG000003956_01033

Basic Information

• Species: RUG131 sp900315885
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-826; RUG131; RUG131 sp900315885
• CAZyme ID: MGYG000003956_01033
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	MGYG000003956_3|CGC1	31954.09	9.4849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003956	1468191	MAG	United Kingdom	Europe

• Gene Location: Start: 10472; End: 11269 Strand: +

Full Sequence      

MNILVSINRPYIKYFLTMINSLSKSNEEETFDIYIMHSNLDDKDKELINSHCPTNMTFHY
IFMHEELFKNAPKDKRYPHEIYYRIFAAKYLPNNLDRVLYLDSDLIVHKSIKKLYNIDFE
NNLFAGCTQIRKMLNTLNKWRLGVKGQKIYLNTGVLLMNLVELRKTLNEDEIMQYINING
WRMILFDQDVIFKFYGDRVKLLDKYIYNLSDRHIKLHNLHSKTKIDLNWVENNNVIIHYL
GKNKPWKDNYNGILQGYYKKYEVKL

Enzyme Prediction     

No EC number prediction in MGYG000003956_01033.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	2	249	1.5e-45	0.8754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	1.33e-62	1	248	1	248	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	7.51e-29	2	249	1	251	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
COG1442	RfaJ	1.74e-23	1	251	3	249	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK15171	PRK15171	2.75e-15	19	248	44	272	lipopolysaccharide 3-alpha-galactosyltransferase.
cd00505	Glyco_transf_8	7.36e-08	11	247	12	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC85976.1	1.49e-70	1	261	1	265
CDX04293.1	7.36e-70	1	265	1	269
BAE85862.1	2.26e-69	1	265	15	283
ACL19350.1	2.95e-69	1	265	1	269
AFL99655.1	1.68e-68	1	265	1	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TZT_A	3.49e-44	3	261	8	267	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
1SS9_A	4.97e-07	1	246	1	252	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43974	3.53e-13	1	246	39	278	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
P27128	7.92e-12	19	248	47	275	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P19817	1.19e-10	72	259	97	283	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P19816	1.20e-10	2	246	29	272	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
A0A0H2URH2	1.57e-09	2	246	4	229	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003956_01033.