CAZyme Information: MGYG000003957_00186

Basic Information

• Species: Parabacteroides sp014287585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp014287585
• CAZyme ID: MGYG000003957_00186
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	MGYG000003957_2|CGC2	89158.37	7.2258

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003957	4724401	MAG	United Kingdom	Europe

• Gene Location: Start: 105589; End: 107940 Strand: +

Full Sequence      

MKTYFPPLFLACALFVTTLSMHAQQFIHVSPTGNDRNAGTKEAPLASLSAAMKVIRTSTE
QEITLFLQNGIYHLEQPLTFSPDILTGKKLLITTLTQSDSVIISGNKKLSLQWEKGKYGI
WKAKTADSFDQLWINGNPRVLARYPNYRKDTLFNGTAEEALSPERIKRWKNPKGGYVHSM
HAGMWGSQHYLITRKIKDSLIYEGGYQVSRPSKIHPELRYVENIREELDAPGEWFLDRKE
QTLYYYPLPEETMQTVVVEAAVTPHLVIIQGTKEKPASNVSINGITFTHTCRTFMERYET
LLRSDWGIYRGAAVLFDNTKDCKISNCEFRELGGNAIFVSRYAYNDTIISNHIHHTGGSA
ICIVGDTSAVRSGAFGYSNFVPFEQMDLTPGPKNKLYPRQCLIEDNLIHNLGTIEKQVAG
VEIQIAAILTIRHNTIYDIPRAGINVGDGAFGGHLIEYNDVFNTVLETSDHGAFNSWGRD
RFWHPRYNEMLRMVQEHPELIFADALYTNILRFNRFRCDHGWDIDLDDGSSNYHIYNNIC
LRGGIKLREGFFRKVENNILINNSLHPHVWFKDSKDVVRRNLFMQPYYPISLNGWGELLD
YNFFTSQMALDKVRKDHTDIHSITGSFNFVDAVRGDYTLEPESNVFEIGFENIPMDRFGV
YSPSLKALAKKPEFPLVQIIDTCDENKTYNWLGATIRVVNGLGDRSAFGLPDEKGIIIVN
IEKGSIADKSGLTRNDVVRAVAGKDISSIEEIFALTEENRWKGKVFIKIFRNQTGEEKRI
SFK

Enzyme Prediction     

No EC number prediction in MGYG000003957_00186.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	27	540	2.4e-67	0.9867172675521821

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00987	PDZ_serine_protease	8.45e-14	691	782	2	90	PDZ domain of trypsin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
pfam13229	Beta_helix	7.68e-09	312	463	1	136	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd00136	PDZ	3.48e-06	690	777	1	64	PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1, a mammalian tight junction protein.
pfam17820	PDZ_6	2.63e-05	717	759	1	43	PDZ domain. This entry represents the PDZ domain from a wide variety of proteins.
pfam13229	Beta_helix	5.20e-05	335	564	1	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW32784.1	2.62e-210	12	765	15	782
BAU63437.1	2.32e-51	26	660	56	728
AFZ35556.1	1.90e-44	28	660	49	710
QIP13872.1	2.65e-37	14	568	13	545
ALJ04165.1	8.27e-36	15	660	12	670

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	3.28e-18	27	449	27	501	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000575	0.998350	0.000441	0.000206	0.000190	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003957_00186.