CAZyme Information: MGYG000003957_03217

Basic Information

• Species: Parabacteroides sp014287585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp014287585
• CAZyme ID: MGYG000003957_03217
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1044		118742.88	6.1115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003957	4724401	MAG	United Kingdom	Europe

• Gene Location: Start: 3106; End: 6240 Strand: +

Full Sequence      

MKHKLSAISALLLFALTGQAQHKEWEDQRINQINREPIHAHFVPYASERAALQKDATLER
RESLNGTWKFHFAGNPASRPASFYEESFDVSGWKDIEVPGSWELQGFDAPIYTDTRYPFP
ANPPYVPQDYNPVGSYVTTFTVPEHFKGKDVLLHFGGVESAYYCWVNGRFVGYSEDSRLP
SEYLINKYLKPGENRLAVEVYRYSDGSYLEGQDYWKYSGIERNVMLIARPKSRIKDFEIR
ADLENQYKDGTLDINFTMDSRSLAKGTSVGLKVLDGTKELASGRLTVRHAADTLLSFSEI
FPDVKRWTAETPNLYTLVVNTLDSKGKVTESFTQRFGFRKVEMKNGMLLVNGTPILVKGV
NRHEHDMHRGRTVSVESMVEDIRLMKQFNINAVRCCHYPNYEEWYDLCNEYGIYLVDEAN
IESHGMEAHPDGTLANMDGWEIPFMERMERMVERDKNVTAIITWSLGNESGYGKHFETIY
HWAKQRDASRPVQYEGGGVKGLSDIYCPMYGRIWLLRQWANQRQERPLILCEYAHAMGNS
VGNLGDYWELIYKYDNLQGGFIWDWVDQTFAIKDQKGKDIWAYGGDMGFVGIVNDSNFCA
NGLVAADRTLHPHIYEVKKIYQYMHFEGVPFSPDQVKVTNRHDFLSSDVYDYSWKVKADG
QTLHEGKLDVPVIAPHASVVVTLPLPTIEGKPGTEYFLHLSACTKEASPLVPKGHLAASE
QWQLPRRPLKESAKEIPNRPFKELAKVDETPDGYTVTASSSVLTFSRKTGEITSLKVKGK
EYLQAGPRPNFWRPLTDNDVANGMLKRCGTWKQAGNELQLTDMSAETHGGTVTICASYTM
PAQESACSVTYVVYPDGAVQTTLSFTPGDKALPEMPRFGMRMILNGEYDRMTWFGRGPHE
NYWDRKSAADIDLYESTVWEQYHPYVRAQETANKTDVRWVALRNASGEGLLVKSLGEPLG
VSAWNFPIEDLYYIPSMTKHIHGGSIEKKDMVWLNIDNRQMGVGGDNTWGAQTHPEYTIT
PVAREYSFWMIPVDGETDSGFANF

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	51	910	6e-231	0.9720744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	0.0	59	912	10	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	0.0	23	1028	15	1020	beta-galactosidase.
PRK10340	ebgA	0.0	23	1044	2	1013	cryptic beta-D-galactosidase subunit alpha; Reviewed
smart01038	Bgal_small_N	1.09e-104	757	1028	1	270	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
pfam02836	Glyco_hydro_2_C	2.95e-103	341	626	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAR50620.1	0.0	4	1033	3	1030
BAR47851.1	0.0	4	1033	3	1030
AEW22198.1	0.0	4	1033	3	1030
ABR39054.1	0.0	1	1039	1	1049
QQY39154.1	0.0	1	1039	1	1049

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	4.83e-278	24	1030	3	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	4.98e-278	24	1030	4	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	2.69e-217	21	1033	3	997	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	4.44e-215	24	1033	9	1001	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
1PX3_A	3.76e-203	21	1031	12	1019	ChainA, beta-galactosidase [Escherichia coli],1PX3_B Chain B, beta-galactosidase [Escherichia coli],1PX3_C Chain C, beta-galactosidase [Escherichia coli],1PX3_D Chain D, beta-galactosidase [Escherichia coli],1PX4_A Chain A, beta-galactosidase [Escherichia coli],1PX4_B Chain B, beta-galactosidase [Escherichia coli],1PX4_C Chain C, beta-galactosidase [Escherichia coli],1PX4_D Chain D, beta-galactosidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	2.73e-277	24	1030	4	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	4.67e-256	24	1019	19	1019	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q6LL68	1.70e-220	15	1032	2	1027	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
A1SWB8	4.17e-216	23	1031	11	1031	Beta-galactosidase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=lacZ PE=3 SV=1
P81650	2.26e-213	23	1027	11	1030	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000510	0.998405	0.000510	0.000198	0.000179	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003957_03217.