CAZyme Information: MGYG000003957_03752

Basic Information

• Species: Parabacteroides sp014287585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp014287585
• CAZyme ID: MGYG000003957_03752
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
156		17486.76	8.6269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003957	4724401	MAG	United Kingdom	Europe

• Gene Location: Start: 4854; End: 5324 Strand: +

Full Sequence      

MKPAQICFVKECLPAALSAGTAFNMNPLVILAQAAFESGWGTSDLAKGFRNYFGLTAYGC
SNAYWHGGKTTVKASAYSLDFRRYDTRENSFLDFARLIRNNYRSAWQVSNDPEAYAKEIA
YSPYISELNGDNRETYRHSIIQIAQTIQAVMALIRA

Enzyme Prediction     

No EC number prediction in MGYG000003957_03752.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	14	147	7.7e-25	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	5.94e-18	14	102	2	90	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	7.05e-18	8	148	46	183	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.86e-15	1	124	158	289	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	1.04e-14	8	148	155	298	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK12713	flgJ	1.02e-13	8	152	184	331	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50705.1	3.03e-101	1	154	1	154
QUT50226.1	3.60e-52	5	151	4	151
QKH97660.1	7.39e-51	8	155	5	152
QJE27387.1	7.39e-51	8	155	5	152
BBK91294.1	7.39e-51	8	155	5	152

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.53e-07	5	107	30	143	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
4Q2W_A	1.58e-07	23	127	182	273	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]
3VWO_A	3.10e-07	8	127	4	132	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.48e-07	8	127	5	133	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.41e-06	8	127	5	133	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X9J3	3.06e-11	8	150	163	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	1.01e-08	8	152	242	393	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
P59205	1.11e-06	23	127	550	641	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	1.12e-06	23	127	594	685	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003957_03752.