CAZyme Information: MGYG000003963_00178

Basic Information

• Species: UMGS1696 sp900753285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1696; UMGS1696 sp900753285
• CAZyme ID: MGYG000003963_00178
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753		83307.17	4.8067

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003963	2551706	MAG	United Kingdom	Europe

• Gene Location: Start: 200156; End: 202417 Strand: -

Full Sequence      

MNTLPKYKDASLPIAERVEDLISRMTPAEKAAQTDMMSGSDFCTKPSPLHNCSVEPDTDY
RFDEMIAICGDNGVGFIHDNYSTPQAQNKLQKYFIEHSRLGIPVIFTGEALHGISGTRGT
IFPCPINLGATFDRELVNEVGQAIGRETRALGMYEILAPNLDVARDIRWGRTEETFGEDT
YLSSRMAAAIVSGEQKGDISRPDAVISEPKHYCVHGIPEGGTNCSPARAGTREVENCYLP
VFEAAIKEGGAYNVMVSYNCVDGDVLMTSEHYLKEVLHDRFHMKGYTRADWGGVARIKND
HKLVTTDRDAIKMALNNGLDVKGLDYPYKFWRETVTDLIEKGEIPEERINEIVRRVLTVK
FELGLFEHPYTDENAWKDIIRCEEHKNIALRAARESVTLLKNDGTLPLDKNEIKSVAVIG
PSSAAQKLGGYSGIPDGYEIKSVYQKLKEVLGDGVTVRQHDGCAITPGEKAPRFVEGQPH
LTSAGEDEIPDDIEGAVKTASECDLIIFVGGDNSITSGEGRDRCDIVLPGKQRELIEELA
KLGKNLIVVLEIGKPADLTVEEKISNGIITAWFGGEFGAQAIVDVLFGDYNPSGRLNISF
PRNVGSIPAYYSMLPGGAGWFYESEKSARYPFGYGLSYTSFEYSNMKIEKRGQYDFDVTV
DVKNTGDRDGDDVVQLYIDDVASSVVTPPLLLKGFERVSLKAGETKTVSFSLTKSSFELM
DIKYRKVVEPGDFRILIAKSSRDVKLEETIHID

Enzyme Prediction     

No EC number prediction in MGYG000003963_00178.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	96	321	4.1e-55	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.43e-162	18	745	38	758	beta-glucosidase BglX.
PLN03080	PLN03080	2.13e-81	99	712	78	742	Probable beta-xylosidase; Provisional
COG1472	BglX	2.99e-73	25	457	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.29e-55	397	638	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.56e-49	95	359	59	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI22074.1	5.03e-313	7	750	3	747
ANS75452.1	1.26e-274	7	753	8	876
BCK00302.1	3.48e-266	6	752	2	871
QAY68112.1	3.53e-190	7	746	9	870
BBI31696.1	8.00e-186	7	745	11	872

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.97e-129	5	752	5	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.52e-128	5	752	5	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	2.57e-128	7	749	36	780	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	2.36e-115	18	741	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.28e-114	18	741	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	9.95e-121	25	748	29	761	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	5.42e-120	25	745	29	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	2.24e-117	97	742	60	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	3.06e-115	7	745	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	2.99e-94	100	749	122	773	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999836	0.000192	0.000010	0.000001	0.000000	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003963_00178.